KEGG   Rhodopirellula baltica: RB2032Help
Entry
RB2032            CDS       T00134                                 

Definition
delta 9 acyl-lipid fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rba  Rhodopirellula baltica
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rba01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rba01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1069776..1070867)
Genome map
AA seq 363 aa AA seqDB search
MGHEFQFTLVLTMSTSEAPAPPESAKRDKLVCDESNDYGSGAVPTEAMAVGETGIDPQRL
PRPEETQPLRIMWQYVIVLSLVHLVALAAFVPAWFSYLFTWSGLIAGIAGHFIFGMFGIT
IGYHRLLTHRGFKCPKWMEHTLAILGMCNLQDSPARWVAIHRMHHQHSDHQPDPHSPLVN
FLWGHMGWVVCRHKDLDKTSHYERYVRDLLRDRFYLKLERKDGWFFVFLIHGIIISLIGG
AVGYAVSGGDWAVAYRYLLSWTVWAVAIRTVFVLHGTWSVNSLSHVFGYRNYDTRDHSTN
NWLVALISHGEGWHNNHHATPRSARHGHKWYEFDMSWGIIRVWEMMGLITDVQRPTKASV
AGK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
ttgggccatgaattccaattcaccctggttttgacgatgtcgacttccgaagcacccgca
ccacctgaatccgcgaaacgcgacaagctggtttgcgatgagtccaacgactacggttcg
ggagccgtcccgaccgaagcaatggccgtcggcgaaaccggaatcgatcctcaacggctc
ccgcgccccgaagagactcagccgctgcgaatcatgtggcagtacgtgatcgtgctgtcg
ctggtccacttggtcgcgttggccgcgtttgtcccagcgtggttttcgtatctgttcact
tggtcgggactgatcgccggaatcgccgggcactttatcttcggcatgttcggcatcacg
attggctatcaccggctgctcacccaccgcggattcaaatgccccaagtggatggaacac
acgctcgcgatcttgggcatgtgcaacctgcaggacagccccgctcgatgggtcgctatt
caccgaatgcaccatcaacacagcgaccaccaacctgacccacactcgccgctggtcaat
ttcctgtggggtcacatgggatgggtcgtttgccgccacaaggatctggataaaaccagc
cactatgaacgttacgttcgcgacttgctgcgagaccgcttctatctgaagctggaacgc
aaagacggatggttcttcgtcttcctgatccacggaatcatcatctcgctgatcggtgga
gcggtcggttatgcggtcagcggtggcgattgggcggttgcctatcgctatctgttgtca
tggaccgtttgggccgttgccatccgaaccgtctttgtgctgcacgggacttggtcggtc
aactcactcagccacgtgttcggttaccgcaactacgacactcgcgatcacagcaccaac
aactggttggtggctttgatcagccacggcgaaggttggcacaacaatcatcacgcgacc
ccacgctcggctcgccacggacacaagtggtacgagtttgacatgtcctggggaatcatc
cgcgtctgggagatgatgggactgatcaccgacgtccaacgtcccaccaaggccagcgtc
gctgggaagtag

DBGET integrated database retrieval system