KEGG   Rhodopirellula baltica: RB2244Help
Entry
RB2244            CDS       T00134                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rba  Rhodopirellula baltica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RB2244
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RB2244
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RB2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1178675..1179253
Genome map
AA seq 192 aa AA seqDB search
MSRFLLLTLALGCLMNAPQPVSAADSTADHECVLAHEAKTIEGKEVDLHDYEGKVVLIVN
VASKCGYTKQYAGLQSLYEAHKDDGLVILGFPCNQFGSQEPGTNADILEFCSARYNVTFP
MMGKVDVNGDDASPLYKQLTSVEAKPAGKGPISWNFEKFLIGRDGQVVGRYKSKVAPSDE
ELVSAIKSALKG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgttttttgcttctcacgctcgccctgggttgtctgatgaatgctcctcaacct
gtttccgccgctgactccactgcggatcacgaatgcgtgttggctcacgaggccaaaacc
atcgaaggcaaggaagtggatctgcacgactacgagggcaaagtcgtcctgatcgtcaac
gtcgctagcaagtgcggctacaccaagcagtacgctgggttgcaatcgctgtacgaagcc
cacaaagacgacggattggtcatcctcgggttcccttgcaatcaattcggctcgcaggaa
cctggcacgaacgcggatattttggaattctgcagcgctcggtacaacgtcaccttcccg
atgatgggcaaagtggacgtcaatggcgatgacgcgtcgcctttgtacaaacagttgacc
agcgttgaagccaaaccggcgggcaaaggtccgatcagttggaacttcgagaagttcttg
atcggtcgcgatggtcaagttgtcggacgctacaaatcgaaggtcgcaccatcggacgaa
gaattggtctcggcgatcaagtcagctttgaagggctga

DBGET integrated database retrieval system