KEGG   Rhodopirellula baltica: RB2373Help
Entry
RB2373            CDS       T00134                                 

Gene name
fdh
Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rba  Rhodopirellula baltica
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rba01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:rba00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:rba00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1230126..1231334)
Genome map
AA seq 402 aa AA seqDB search
MSDNKGVVYLGAGKVDVQSIDDPKLELSYRGKTRQCHHGVILKVISTNICGSDQHMVRGR
TTAPAGMVLGHEITGEVIEVGRDVEFIKKGDICSVPFNIACGRCRCCKEGDTGVCENVNP
DRPGAAYGYVDMGGWIGGQSRYVMVPYADWNLLAFPDRDQALAKIRDLTMLSDIFPTGYH
GAYTAGVTTGSTVYVAGAGPVGLACAHAAQLLGAAVVIVGDMVEERLAQARSFGCETVDL
KTDASLPDMIEQILGSREVDCAVDCVGFEARGHGGDSGVEKPATVLNQVMEVTRVGGGVG
IPGLYVTDDPGGVDEAARTGNLSLRIGLGWAKSLHFTTGQCPVMKYNRGLMMAILHDRCQ
IAKAVNATVISLDDAPQGYADFDQGAAKKFVLDPHGVLAAST
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaacaaaggtgttgtgtatctgggtgccggaaaggtcgatgttcaatcgatc
gacgatcccaaactggaactcagctaccgaggcaaaactcggcagtgccaccacggagtg
atcttgaaggtcatctccacaaacatttgcggatccgaccaacacatggttcgcggacgc
acaaccgccccggccggcatggtgctcgggcacgagatcacgggcgaagtcattgaggtc
ggccgtgacgttgaattcatcaagaagggtgacatctgcagcgtcccgttcaacatcgct
tgcggtcgatgccgttgctgcaaagaaggcgacaccggagtttgtgaaaacgtgaaccct
gatcgccccggcgcagcgtatggctacgtcgacatgggcggctggatcggcggccaatca
cgatacgtcatggttccctatgcggattggaatttgctggcgtttcccgaccgtgatcaa
gctctcgcgaaaattcgcgacttgaccatgttgtcggacattttcccgaccggttaccac
ggtgcatacaccgcgggggtgaccaccggcagcaccgtgtatgtcgcaggagccggcccg
gtgggtcttgcttgtgctcacgcggcccagttgcttggagcagcggttgtgatcgttgga
gacatggtggaagaacgactcgcacaggcacgctcgtttggttgcgaaacggttgacctc
aaaaccgatgcctcgctgcctgacatgatcgaacagatcctgggttcccgagaagtcgat
tgtgccgtcgactgcgttggattcgaagcccgcggccacggtggtgattcaggcgtcgaa
aaacccgccacggtgctcaaccaagtcatggaagtcacccgggtcggaggcggcgttggg
atccctggtctgtatgtgacggacgatccaggcggggtcgacgaagccgcccgaaccggc
aacctatcgctccgaatcggtttgggttgggccaagtccctgcacttcaccaccggccag
tgccccgtgatgaagtacaatcgaggcctgatgatggcgattttgcatgaccgatgccag
atcgccaaagcggtcaatgcaacggtgatttcgttggacgatgcccctcaaggctacgcc
gatttcgaccaaggcgccgcgaaaaaattcgtgctcgacccacacggcgtcctggctgct
tccacttaa

DBGET integrated database retrieval system