KEGG   Rhodopirellula baltica: RB2373Help
Entry
RB2373            CDS       T00134                                 

Gene name
fdh
Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rba  Rhodopirellula baltica
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RB2373 (fdh)
  Energy metabolism
   00680 Methane metabolism
    RB2373 (fdh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RB2373 (fdh)
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     RB2373 (fdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1230126..1231334)
Genome map
AA seq 402 aa AA seqDB search
MSDNKGVVYLGAGKVDVQSIDDPKLELSYRGKTRQCHHGVILKVISTNICGSDQHMVRGR
TTAPAGMVLGHEITGEVIEVGRDVEFIKKGDICSVPFNIACGRCRCCKEGDTGVCENVNP
DRPGAAYGYVDMGGWIGGQSRYVMVPYADWNLLAFPDRDQALAKIRDLTMLSDIFPTGYH
GAYTAGVTTGSTVYVAGAGPVGLACAHAAQLLGAAVVIVGDMVEERLAQARSFGCETVDL
KTDASLPDMIEQILGSREVDCAVDCVGFEARGHGGDSGVEKPATVLNQVMEVTRVGGGVG
IPGLYVTDDPGGVDEAARTGNLSLRIGLGWAKSLHFTTGQCPVMKYNRGLMMAILHDRCQ
IAKAVNATVISLDDAPQGYADFDQGAAKKFVLDPHGVLAAST
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaacaaaggtgttgtgtatctgggtgccggaaaggtcgatgttcaatcgatc
gacgatcccaaactggaactcagctaccgaggcaaaactcggcagtgccaccacggagtg
atcttgaaggtcatctccacaaacatttgcggatccgaccaacacatggttcgcggacgc
acaaccgccccggccggcatggtgctcgggcacgagatcacgggcgaagtcattgaggtc
ggccgtgacgttgaattcatcaagaagggtgacatctgcagcgtcccgttcaacatcgct
tgcggtcgatgccgttgctgcaaagaaggcgacaccggagtttgtgaaaacgtgaaccct
gatcgccccggcgcagcgtatggctacgtcgacatgggcggctggatcggcggccaatca
cgatacgtcatggttccctatgcggattggaatttgctggcgtttcccgaccgtgatcaa
gctctcgcgaaaattcgcgacttgaccatgttgtcggacattttcccgaccggttaccac
ggtgcatacaccgcgggggtgaccaccggcagcaccgtgtatgtcgcaggagccggcccg
gtgggtcttgcttgtgctcacgcggcccagttgcttggagcagcggttgtgatcgttgga
gacatggtggaagaacgactcgcacaggcacgctcgtttggttgcgaaacggttgacctc
aaaaccgatgcctcgctgcctgacatgatcgaacagatcctgggttcccgagaagtcgat
tgtgccgtcgactgcgttggattcgaagcccgcggccacggtggtgattcaggcgtcgaa
aaacccgccacggtgctcaaccaagtcatggaagtcacccgggtcggaggcggcgttggg
atccctggtctgtatgtgacggacgatccaggcggggtcgacgaagccgcccgaaccggc
aacctatcgctccgaatcggtttgggttgggccaagtccctgcacttcaccaccggccag
tgccccgtgatgaagtacaatcgaggcctgatgatggcgattttgcatgaccgatgccag
atcgccaaagcggtcaatgcaacggtgatttcgttggacgatgcccctcaaggctacgcc
gatttcgaccaaggcgccgcgaaaaaattcgtgctcgacccacacggcgtcctggctgct
tccacttaa

DBGET integrated database retrieval system