KEGG   Rhodopirellula baltica: RB2568Help
Entry
RB2568            CDS       T00134                                 

Definition
(RefSeq) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rba  Rhodopirellula baltica
Pathway
rba00051  Fructose and mannose metabolism
rba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RB2568
Enzymes [BR:rba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     RB2568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 1790356
NCBI-ProteinID: NP_865033
UniProt: Q7UVK7
Position
complement(1340281..1341144)
Genome map
AA seq 287 aa AA seqDB search
MQNIHKIKQDMCDIGRRIYNRQFAAANDGNITVRVSENEVLCTPTMHCKGYLTPDDISMI
DMTGKQIAGRKKRSSEALLHLEIYKQRADIKSVVHCHPPHATAFAIAREPIPQCILPEVE
VFLGDVPITKYETPGGQAFADTIIPFVEKTNVMILANHGTVSYGESVERAYWWTEILDSY
CRMLLLAKQLGNVSYLDETKSRELLELKDKWGFKDPRNTSEYEDCDICANDIFRDSWKDS
GVERRAFAPPPPIKTSGSASSAPAGVDEEQLVKLITNEVMRQMKASS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacatccataagatcaaacaagacatgtgcgacatcggtcgccgcatctacaac
cgtcaattcgcggcggccaacgacggcaacatcaccgtccgcgtcagcgaaaacgaagtc
ctctgcacaccgacgatgcattgcaaaggctatttgacgcccgacgacatctcgatgatc
gacatgaccggcaaacaaatcgctggtcgcaaaaaacgcagcagcgaagcgttgttgcac
ctggaaatctacaagcaacgtgctgacatcaagtccgtcgttcactgccacccaccacac
gcgaccgcgttcgcgatcgctcgcgagccgattccacagtgcatcttgccggaagtcgaa
gtcttcctcggcgacgtcccgatcaccaagtacgaaacacctggcggacaagccttcgcc
gacacgatcattcctttcgttgaaaaaacgaacgtgatgattttggccaaccacggcacc
gtgtcttatggcgaatcggttgaacgagcctactggtggactgaaattcttgactcgtac
tgccgtatgttgttgctcgccaagcaactgggcaacgtgtcatacttggacgaaaccaag
tcacgtgagttgctggaactgaaagacaaatggggcttcaaagacccacgcaacacgtcc
gagtacgaagattgcgacatctgcgccaacgacatcttccgcgattcgtggaaagactcg
ggtgtggaacgtcgtgcattcgctccaccaccaccgatcaaaacatccggctcggcttcg
tcggcacctgctggtgttgatgaggaacagctcgtgaagctgatcaccaacgaagtcatg
cgtcagatgaaagcgtcgagctag

DBGET integrated database retrieval system