KEGG   Rhodopirellula baltica: RB304Help
Entry
RB304             CDS       T00134                                 

Definition
(RefSeq) cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
rba  Rhodopirellula baltica
Brite
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RB304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C DHOR DUF1924
Motif
Other DBs
NCBI-GeneID: 1791860
NCBI-ProteinID: NP_863829
UniProt: Q7UYY8
Position
151755..153029
Genome map
AA seq 424 aa AA seqDB search
MLRFNDAFPNTLNFTMTIHRFLMCAAATLVAAGPTAFAAETVSLGDPTLTAGIPGDGPLT
LEQAQRFLADDDNHTELNVELPKGLDAASGNIYIPEDNPITRAKIELGRQLYFDPRLSAD
GTISCATCHAPETGWGAPTQFGEGIRGQTGNRNSPVSFNRILSKHQFHDGRAASLEEQAV
GPIANPIEMGNTHEVCVKTLADNPVYKAQFDKVFDDGVTIDNIGKALATFERAIVTGPAP
YDYYAPLSAFEKTFAEDLEYLDEEPALAEQYAKLKEEAAKNPMTESSIRGMELTFGKANC
TACHAGANFTDEQFHNIGVGMDSENPDLGRFEVTKEEKDRGAFKTPTMRNVADTGPYMHD
GSQATLEEVIEWYNKGGHPNPYLSNKMKPLNLTEQEKADLVEFMRQGLQSDFPVIEAGRL
PAEG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtttcaacgacgccttcccaaacactttgaatttcaccatgaccattcatcgc
ttcttgatgtgtgccgcggcgactttggttgccgccggcccaaccgccttcgccgccgaa
accgtttcgctcggcgacccaacactcaccgctggaatccccggcgacggccctctgacg
ctggaacaagcccaacgttttttggccgatgacgacaaccacacggaactgaacgttgaa
cttcccaaggggctcgatgccgcctcgggcaacatttatatcccggaagacaacccgatc
acgcgagccaaaatcgagctgggacgtcagctgtatttcgacccgcgcctgtcagccgac
ggcacgatctcttgcgccacatgccacgcacctgaaaccggctggggtgccccgactcaa
tttggcgaaggcatccgaggtcaaaccggcaaccgcaactcaccggtctcgttcaatcgc
atcctcagcaaacatcaattccatgatggacgcgcggcgtccttggaagagcaagccgtg
ggaccgatcgccaacccaatcgaaatgggcaatacccacgaagtctgcgtgaagacactc
gctgacaacccggtctacaaagctcagtttgacaaggtattcgacgatggtgtgacgatc
gataacatcggcaaagcactggccacgttcgaacgagcgatcgtgaccgggcccgctccg
tacgactactacgctcctttgtcggcgtttgaaaaaacgtttgccgaagatttggaatac
ctcgacgaagagcccgcactcgccgagcaatatgccaagctgaaagaagaagccgccaaa
aacccgatgaccgaatcatcgattcgcggcatggaactgacctttggaaaagccaactgc
accgcctgccacgcgggtgccaacttcaccgacgagcaatttcataacatcggtgttggc
atggattcggagaatcctgacttgggtcgtttcgaagtgaccaaagaagaaaaggatcgc
ggcgcattcaaaacgcccaccatgcgtaacgtcgccgacacgggaccgtacatgcacgac
ggcagtcaagcgacgctggaagaagtcatcgagtggtacaacaaaggtggacaccccaac
ccctacctcagcaacaagatgaagccactgaacttgaccgaacaagagaaagcggacttg
gtcgagttcatgcgtcagggattgcaaagcgatttccccgtcatcgaagccggccgttta
ccagccgaaggctga

DBGET integrated database retrieval system