KEGG   Rhodopirellula baltica: RB304Help
Entry
RB304             CDS       T00134                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rba  Rhodopirellula baltica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
151755..153029
Genome map
AA seq 424 aa AA seqDB search
MLRFNDAFPNTLNFTMTIHRFLMCAAATLVAAGPTAFAAETVSLGDPTLTAGIPGDGPLT
LEQAQRFLADDDNHTELNVELPKGLDAASGNIYIPEDNPITRAKIELGRQLYFDPRLSAD
GTISCATCHAPETGWGAPTQFGEGIRGQTGNRNSPVSFNRILSKHQFHDGRAASLEEQAV
GPIANPIEMGNTHEVCVKTLADNPVYKAQFDKVFDDGVTIDNIGKALATFERAIVTGPAP
YDYYAPLSAFEKTFAEDLEYLDEEPALAEQYAKLKEEAAKNPMTESSIRGMELTFGKANC
TACHAGANFTDEQFHNIGVGMDSENPDLGRFEVTKEEKDRGAFKTPTMRNVADTGPYMHD
GSQATLEEVIEWYNKGGHPNPYLSNKMKPLNLTEQEKADLVEFMRQGLQSDFPVIEAGRL
PAEG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtttcaacgacgccttcccaaacactttgaatttcaccatgaccattcatcgc
ttcttgatgtgtgccgcggcgactttggttgccgccggcccaaccgccttcgccgccgaa
accgtttcgctcggcgacccaacactcaccgctggaatccccggcgacggccctctgacg
ctggaacaagcccaacgttttttggccgatgacgacaaccacacggaactgaacgttgaa
cttcccaaggggctcgatgccgcctcgggcaacatttatatcccggaagacaacccgatc
acgcgagccaaaatcgagctgggacgtcagctgtatttcgacccgcgcctgtcagccgac
ggcacgatctcttgcgccacatgccacgcacctgaaaccggctggggtgccccgactcaa
tttggcgaaggcatccgaggtcaaaccggcaaccgcaactcaccggtctcgttcaatcgc
atcctcagcaaacatcaattccatgatggacgcgcggcgtccttggaagagcaagccgtg
ggaccgatcgccaacccaatcgaaatgggcaatacccacgaagtctgcgtgaagacactc
gctgacaacccggtctacaaagctcagtttgacaaggtattcgacgatggtgtgacgatc
gataacatcggcaaagcactggccacgttcgaacgagcgatcgtgaccgggcccgctccg
tacgactactacgctcctttgtcggcgtttgaaaaaacgtttgccgaagatttggaatac
ctcgacgaagagcccgcactcgccgagcaatatgccaagctgaaagaagaagccgccaaa
aacccgatgaccgaatcatcgattcgcggcatggaactgacctttggaaaagccaactgc
accgcctgccacgcgggtgccaacttcaccgacgagcaatttcataacatcggtgttggc
atggattcggagaatcctgacttgggtcgtttcgaagtgaccaaagaagaaaaggatcgc
ggcgcattcaaaacgcccaccatgcgtaacgtcgccgacacgggaccgtacatgcacgac
ggcagtcaagcgacgctggaagaagtcatcgagtggtacaacaaaggtggacaccccaac
ccctacctcagcaacaagatgaagccactgaacttgaccgaacaagagaaagcggacttg
gtcgagttcatgcgtcagggattgcaaagcgatttccccgtcatcgaagccggccgttta
ccagccgaaggctga

DBGET integrated database retrieval system