KEGG   Rhodopirellula baltica: RB309Help
Entry
RB309             CDS       T00134                                 

Gene name
chlI
Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RB309 (chlI)
Enzymes [BR:rba01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RB309 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(154993..156441)
Genome map
AA seq 482 aa AA seqDB search
MTSPVPSPAKTTMDAPEARNLQQLIESGWKSKSVKQEIRDNFSRMLANREELFPGIVGYE
DTVIPEISLALLAGHDMLFMGEKGQAKSRIMRQLVQFLDPWIPFIDHPDLPVHEDPLNPI
SSLGKRLVAEHSPEDIQIGWWHRSERYAERLSPGTKFADIIGEIDPAKLTGGVSMSAEEA
LSFGLIPRMHRGIFAMNELPELDDLVQVGLFNILEERDVQIRGYPIRFELDVMILFSANP
STYNRSGKVIPQLKDRIGTIVQTHYPSERTQGIEILQQEVGDDLGGPYPVHVPLFMYQII
EEITHQARQSKYIDQASGVSARFSLANFRTIVASARQRGIVHGESPAVPRISDLGHLYAS
SLGKLELDLMGTHQMTEKQVIDSVIAEAIQTVFGEYIEEHGLAEIAEIFRGGVRVEVGTM
LPSSEYAERLQHVPPAWDRAFEVNASENEAMRASCVEFVLAGLYSMDKISRSQRHGKISY
ET
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagccctgtgccaagtcccgcgaaaacgacgatggatgcccccgaagcccgcaat
ttgcagcaattgatcgagagcggatggaaatccaaatcggtcaagcaagaaatccgcgac
aacttttcgcggatgctggccaaccgtgaagagttgtttccgggcattgtgggatacgaa
gacacggtcatcccagaaatcagtctggcgttgttggccggtcacgacatgttgttcatg
ggcgaaaaaggccaagccaaaagccgaatcatgcggcagttggttcaatttctcgatccg
tggattcctttcatcgatcacccggatcttcccgttcacgaggacccgctgaacccgatt
tcatccttgggtaagcgtttggtcgccgagcattccccggaagacatccaaatcgggtgg
tggcatcgcagcgaacggtatgcggaacggttgtcccccgggaccaaattcgcggacatt
attggcgaaatcgatccggcaaaattgacgggcggagtcagcatgagtgccgaggaagca
ctctcgtttggtttgatcccgcggatgcaccgcggcattttcgcgatgaacgaattgccc
gagctggatgatttggtccaagtcggtttgttcaacatcctggaagaacgcgacgtccaa
attcgtggctatcccattcgattcgaactggacgtgatgattttgttctcggccaacccg
tcgacctacaaccgatccggcaaagtcattcctcagctgaaggaccgaatcgggacgatc
gtgcaaactcactatccgtccgaacggacgcagggaatcgaaatcctgcagcaagaggtt
ggcgacgatttgggtggtccttacccggtgcatgtgcctctgttcatgtaccaaatcatt
gaggaaatcactcatcaagctcgccagagcaaatacatcgatcaggcgtcgggggtgtca
gcacgtttctcgttggcgaatttccggacgatcgtcgcctcggctcgccaacgcggtatc
gtgcacggcgaaagtcccgccgttcctcgaatcagcgacctcgggcatctgtatgccagc
agcctcggcaagctggaattggatctgatgggcacgcaccaaatgaccgagaagcaagtg
attgattcggtgatcgcggaagccattcaaactgtgttcggcgaatacatcgaagaacac
gggctggcggaaatcgcggagatcttccgcggcggcgttcgcgtggaagtcggaacgatg
ctgccgagcagcgaatacgcggagcggttgcagcatgttcctccagcatgggaccgtgcg
tttgaggtcaatgcgagcgaaaacgaagcgatgcgagcatcgtgcgtcgagttcgttctc
gcggggctctatagcatggataaaatcagccgctcgcaacgccacggcaagatcagctac
gaaacttga

DBGET integrated database retrieval system