KEGG   Rhodopirellula baltica: RB3109Help
Entry
RB3109            CDS       T00134                                 

Gene name
mauG
Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rba  Rhodopirellula baltica
Brite
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RB3109 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1611359..1612594
Genome map
AA seq 411 aa AA seqDB search
MLTCGAVGLAAEPLASKSNVAGQGGAAETRALNLPDKPFNYSDIDWPEHFQSAVERFDNT
PPDNPLTDHGATLGRVLFYDKSLSANGTVSCASCHKQELSFTDDEPLSVGFDGKKVARNS
MSLVNARFYQRGRFFWDERARTLEQQVLMPIENPIEMGHDLDKLIPQLASDPIYPPLFIN
AFGSSDVTVDRVAKALAQFVRSIVSFQSKYDIGLAKSGSYRRPFPNFTEQENLGKDVFLR
RANCASCHMSNALPFNPHRPDEPYDSSKRPPRQTAFFTMTTPAVNGVDADTDEVDLGVGA
ISSAEMDRGRFKSPSLRNVELTGPFMHDGRFHTLDQVVEHYNWSIKPHPNLDGRLKNFSA
NGMGLPEVPKVALVAFLKTLTDRTILTDEKWSDPFVRTGSDDPPGHSATAE
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
ttgctcacatgcggcgcggttggtctcgcggcggagccgctcgcgagcaagtcgaatgtg
gcggggcagggcggtgcagcagaaacgcgtgcgctgaatctgccggacaagccgtttaac
tacagcgacattgattggccggaacactttcagtccgcagtggaacgctttgacaacact
ccgccggacaatccgctgaccgatcatggtgcgacgcttggacgcgtgttgttctacgac
aaatcgctatcggccaacggaacggtttcgtgtgcctcctgtcacaagcaagaattgtca
ttcaccgatgacgaaccgctgagcgttggctttgacgggaagaaggttgctcgcaattcg
atgagtctcgtgaacgctcgtttctatcaacgaggtcgcttcttttgggacgagcgtgct
cgcacgttggaacaacaagtcttgatgccgatcgaaaacccgatcgagatggggcatgat
ctggacaagttgattccacagttagcgtcggacccaatctacccgcctctgttcatcaac
gcgtttgggtcgtcggatgtcacggtcgatcgagtcgccaaagcgttggcacaatttgtt
cgctcgatcgtttcctttcaatcgaagtatgacattggtttggcgaaatccggttcatat
cgcagaccgttcccaaacttcaccgaacaagagaacttgggaaaggacgttttccttcgt
cgagccaattgtgcgtcttgtcacatgagcaacgcgttgcctttcaacccccatcgtcct
gacgaaccgtacgattcgtcgaagcgaccgcctcgacaaacagcgttcttcaccatgacg
actccagccgtcaacggcgtcgatgcggacacggacgaggttgacttgggtgtgggtgcg
atcagcagtgccgaaatggatcgcgggcgcttcaagtctccgtcgcttcgcaacgttgaa
ctgaccggaccgttcatgcacgacggacgattccatacgctggaccaagtcgtcgagcat
tacaactggagcatcaagccgcacccgaacttggacggacgactgaagaacttttccgcc
aatgggatggggttgcccgaagtgcccaaggtggctctggtcgcgttcctgaaaacgctg
accgatcgcacgattctgacggacgaaaagtggagcgatccattcgtgcggactggctcg
gacgatcctccggggcattccgcgacggccgaatag

DBGET integrated database retrieval system