KEGG   Rhodopirellula baltica: RB3555Help
Entry
RB3555            CDS       T00134                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rba  Rhodopirellula baltica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RB3555 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB3555 (glcK)
   00052 Galactose metabolism
    RB3555 (glcK)
   00500 Starch and sucrose metabolism
    RB3555 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    RB3555 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RB3555 (glcK)
   00524 Butirosin and neomycin biosynthesis
    RB3555 (glcK)
Enzymes [BR:rba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RB3555 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1849463..1850161
Genome map
AA seq 232 aa AA seqDB search
MFFQKPVALLNDADAAALAESAHGLCRANSLVLMTLGTGVGGGVILDGRPIRGANGCGGE
IGHATIDFSSDARMCGCGFPGHLEAYAGSAGVIQTANEILKQTDALSALRGMKSLTPLAI
ANAAADGDSIAIRVIHQTGVVIGRSIAMFAHVVDPDVVLLGGAMTFGGPGTDTGKQFLQS
IREECFPRTLVQISSHLKIEFATLGNDAGIVGAAHYSRQMAGETSWPGTAIR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtttttccagaaaccggttgcgcttctgaacgatgccgacgccgctgcgttggctgag
tcagcccatggtttgtgccgagcgaactctttggtgttgatgacgcttggaaccggagtg
ggaggcggggtcatcttggacggtcgtccgattcgaggagcgaatggatgcggtggcgag
attggacacgcgaccattgatttttcatccgacgctcgaatgtgcgggtgcggctttcct
gggcatctggaagcgtatgccggatcggcgggcgtcattcaaacggcgaatgagatactg
aagcagaccgacgcgttgagtgcgttacgaggaatgaaatcgctgacgccgttggcgatc
gcgaatgccgcggccgatggagattcgattgcgatccgagtcattcaccaaaccggcgtg
gtgatcggacgatcaattgcgatgttcgctcacgttgtggatcccgacgttgtgcttttg
ggcggcgcaatgacgtttggtggcccaggaaccgacaccggaaagcagtttctgcaatcg
attcgcgaggagtgttttcctcggaccctggtgcaaatcagctcgcatctgaagatcgag
tttgcaaccttagggaacgatgccgggattgttggtgcggctcactattctcggcaaatg
gccggcgagacctcttggcccggaaccgctataagatag

DBGET integrated database retrieval system