KEGG   Rhodopirellula baltica: RB3938Help
Entry
RB3938            CDS       T00134                                 

Definition
(RefSeq) hypothetical protein
  KO
K09154  
uncharacterized protein
Organism
rba  Rhodopirellula baltica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2037020..2037607
Genome map
AA seq 195 aa AA seqDB search
MILESLVTTLDEQGRINLAPLGPIVLPPQSPGGLPQFLLRPYEGSTTCDNLLASGNAVIH
VIDDALLIAKTAIGKVDASDLVVPIPGLEDTHVRLKRCHRWFAVRVTQRAGTPPRHELTA
RCLASGLVDPFFGFNRAKHAVIEAAVAATRLHLLPPEEIEEELERARIAIEKTGGEPERE
ALQLIRRHVRESSIS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgatcttggaatcattggtcacgacactcgacgaacagggacgcatcaacctggcaccg
ctgggaccgatcgtgttgccaccgcaatcgcctggtggccttccgcagttcttgcttcgt
ccctacgagggatcgaccacttgcgacaatttgctcgcaagtggaaacgccgtcattcat
gtgatcgacgatgctctactgatcgcgaaaacagcgattggcaaagtcgacgcgagcgat
ttggtcgtccccattcctggattggaagacacccatgtgcgattgaagcgatgtcatcgt
tggttcgccgttcgagtcacgcagcgtgccggaacgccaccacgacacgagctcaccgcg
agatgtctggcttcgggattggtcgacccattttttggattcaatcgtgccaagcatgcg
gtgatcgaagccgctgttgccgccacgcggttgcatctgctgcctcccgaggaaatcgaa
gaagaactcgagcgagctcgaatcgcgatcgaaaaaaccggcggtgagcctgagcgagaa
gcgttgcaattgattcggcgacacgtgcgagagtcgtcgatctcatga

DBGET integrated database retrieval system