KEGG   Rhodopirellula baltica: RB4024Help
Entry
RB4024            CDS       T00134                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
rba  Rhodopirellula baltica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2079821..2080666
Genome map
AA seq 281 aa AA seqDB search
MRSLSQRVLMSVLFCLVSMSVITVPAFAQRTRKPITWVNSDIPNFPGLEHKVLKSETLGH
EVGYVVWTPPGFSVDADTRYPVVYFLHGAGGNERSDAAGFASLIAKGIQDKTMPPAICVC
PNGGMSGYRGEVESMIVDELIPLIDSTYPTRADAQSRVIAGFSMGGAGSVRLSLLHPDLF
CAAGSWGGALAFRGEPEKSPLLPAVKENADTLRKNGYAALLINGDSDRPDAFALLAETFR
SHDISHQVVIVENTKHNLGDYHKKTADQMISFLGKQLLRNR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagatcattgtcacagcgcgtattgatgtcagttttgttctgtctcgtcagcatgtcc
gtcatcacggttccagccttcgctcagcgaactcgcaaaccgatcacctgggtcaattcg
gacattccaaacttccccggtttggaacacaaggttctcaaaagcgaaacgctgggacat
gaggtgggatatgtcgtttggacgccgccgggattttccgttgatgctgacactcgttat
cccgtcgtctatttcctgcatggtgctggcggaaatgaacgatcagacgccgctggtttc
gcatcgctgattgccaaaggcattcaagacaaaacgatgccgccagcgatttgtgtttgt
cccaacggcggaatgagcggctaccgaggtgaagtggagtcgatgatcgtcgacgagttg
atcccattgatcgactcgacttatcccacccgagctgacgcgcaatcgcgagtcatcgcg
ggtttctcaatgggcggagccggttcggttcgactatcgctgctgcatcccgacttgttt
tgtgccgcgggcagctggggcggagcgttggcgttccgtggcgaacctgaaaaaagccct
ctgcttccagccgtgaaagagaacgccgacacacttcgtaagaatggttacgccgcgttg
ctgatcaacggagacagcgaccgccccgacgcgtttgcattgcttgcagaaacgtttcga
tcacacgatatttcgcaccaggtcgtgatcgtcgagaacaccaaacacaatctcggagac
taccacaagaagaccgcggatcaaatgatctccttccttggcaaacagctcctacgaaac
cgttga

DBGET integrated database retrieval system