KEGG   Rhodopirellula baltica: RB4131Help
Entry
RB4131            CDS       T00134                                 

Gene name
yjjN
Definition
zinc-type alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:rba01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rba00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rba00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rba00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:rba00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:rba00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126371..2127399
Genome map
AA seq 342 aa AA seqDB search
MKALQLSAPKQWEQIEIDEPSPPGPGEALVRIHRVGVCGTDLGGYLGKFPFFSYPRIPGH
ELGVEVVAVGEGVENVKVGDRCSVEPYINCQKCYSCERGLTNCCESHQTLGVMCDGGLTE
KMILPARKLHPANNLSYEQSALVETLAIGCHAIDRAHVTEKDTVLVIGSGPIGLSAIEFA
RVAGARVIVADLSQTRLDFVTEKMGMTDTIQFDGSEADIEKLEAMTDGRRADVVVDATGN
HHSMRRAMEMAAFGGRVVYVGITQQDLQFPHAPFLHRRELTILASRNALTGDFARIIQLI
ESGVIDTDPWITHHAKFEEVIESFPAWTDPESGVVKAVIHIS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttgcaactgagtgctccgaaacagtgggagcagatcgaaatcgacgaacca
tcgccgccgggtcccggtgaagcgttggtgcgaattcaccgcgtcggtgtttgcggtacg
gacttgggtggttacctcggtaagttcccattcttttcctacccccgaattcccggccat
gaattgggcgtggaagtcgtcgcggttggcgaaggtgtcgagaacgtgaaggtcggcgat
cgctgcagcgtcgaaccgtacatcaattgccagaagtgttattcctgtgaacgtggtctg
acgaactgctgcgaatcacaccaaacactcggcgtgatgtgcgacggcggactgactgaa
aagatgatcttgcccgcccgcaaactgcatcccgccaacaatctttcttacgagcaatca
gcgctcgttgaaacattggcaattggttgccacgccatcgatcgcgcccatgtgaccgaa
aaggacaccgttttggtgattggttcgggccccattgggttgtcggcgatcgagttcgct
cgtgtcgcaggagccagggtcattgtcgctgacctcagccaaacgcggttggactttgtg
accgagaagatgggcatgaccgacaccattcagtttgatggatccgaagcggacattgaa
aaactggaagcgatgaccgatggtcgtcgcgcggacgttgtggtcgatgcgacgggcaac
catcactccatgcgtcgtgcgatggagatggctgcgttcggcggacgagtcgtctacgtc
gggatcactcagcaagacctgcagttcccgcacgcaccgtttttgcatcgccgtgagttg
acgattctggccagtcgcaatgcgttgactggagattttgctcgcatcattcaattgatc
gagtcgggcgtcatcgacactgatccatggatcacacatcacgcgaaatttgaggaagtc
atcgagtccttcccggcttggacggatccggaatctggcgtcgtgaaagccgtgatccac
atttcctaa

DBGET integrated database retrieval system