KEGG   Rhodopirellula baltica: RB4131Help
Entry
RB4131            CDS       T00134                                 

Gene name
yjjN
Definition
zinc-type alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RB4131 (yjjN)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB4131 (yjjN)
  Lipid metabolism
   00071 Fatty acid degradation
    RB4131 (yjjN)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RB4131 (yjjN)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RB4131 (yjjN)
   00626 Naphthalene degradation
    RB4131 (yjjN)
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RB4131 (yjjN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126371..2127399
Genome map
AA seq 342 aa AA seqDB search
MKALQLSAPKQWEQIEIDEPSPPGPGEALVRIHRVGVCGTDLGGYLGKFPFFSYPRIPGH
ELGVEVVAVGEGVENVKVGDRCSVEPYINCQKCYSCERGLTNCCESHQTLGVMCDGGLTE
KMILPARKLHPANNLSYEQSALVETLAIGCHAIDRAHVTEKDTVLVIGSGPIGLSAIEFA
RVAGARVIVADLSQTRLDFVTEKMGMTDTIQFDGSEADIEKLEAMTDGRRADVVVDATGN
HHSMRRAMEMAAFGGRVVYVGITQQDLQFPHAPFLHRRELTILASRNALTGDFARIIQLI
ESGVIDTDPWITHHAKFEEVIESFPAWTDPESGVVKAVIHIS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttgcaactgagtgctccgaaacagtgggagcagatcgaaatcgacgaacca
tcgccgccgggtcccggtgaagcgttggtgcgaattcaccgcgtcggtgtttgcggtacg
gacttgggtggttacctcggtaagttcccattcttttcctacccccgaattcccggccat
gaattgggcgtggaagtcgtcgcggttggcgaaggtgtcgagaacgtgaaggtcggcgat
cgctgcagcgtcgaaccgtacatcaattgccagaagtgttattcctgtgaacgtggtctg
acgaactgctgcgaatcacaccaaacactcggcgtgatgtgcgacggcggactgactgaa
aagatgatcttgcccgcccgcaaactgcatcccgccaacaatctttcttacgagcaatca
gcgctcgttgaaacattggcaattggttgccacgccatcgatcgcgcccatgtgaccgaa
aaggacaccgttttggtgattggttcgggccccattgggttgtcggcgatcgagttcgct
cgtgtcgcaggagccagggtcattgtcgctgacctcagccaaacgcggttggactttgtg
accgagaagatgggcatgaccgacaccattcagtttgatggatccgaagcggacattgaa
aaactggaagcgatgaccgatggtcgtcgcgcggacgttgtggtcgatgcgacgggcaac
catcactccatgcgtcgtgcgatggagatggctgcgttcggcggacgagtcgtctacgtc
gggatcactcagcaagacctgcagttcccgcacgcaccgtttttgcatcgccgtgagttg
acgattctggccagtcgcaatgcgttgactggagattttgctcgcatcattcaattgatc
gagtcgggcgtcatcgacactgatccatggatcacacatcacgcgaaatttgaggaagtc
atcgagtccttcccggcttggacggatccggaatctggcgtcgtgaaagccgtgatccac
atttcctaa

DBGET integrated database retrieval system