KEGG   Rhodopirellula baltica: RB4161Help
Entry
RB4161            CDS       T00134                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rba  Rhodopirellula baltica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RB4161 (malQ)
Enzymes [BR:rba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RB4161 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2137708..2139225
Genome map
AA seq 505 aa AA seqDB search
MRFPRSSGILCHITSLPSELGIGDLGSAAYEMVDFLHAAGQSIWQILPLSPPAYGNSPYS
AYSAFGGNALLISLEALVDEGLLETSDLDGFTQTDPARVDFGTVSEFKHARLKLAYERYL
TKPPRELKIAFELFLDANDWWLDEFSLFEVFLNKFEQSNWSKWPDPIRRREPDALGQARQ
EMSREIDYSRFQQFLFDRQWNRLKAYANERQVQLCGDMPIFVAYESADVWGNQDMFALND
DGTPKLVAGVPPDYFSETGQLWGNPQYDWDALEKADYAWWTARFRRSLEQFDLLRVDHFR
GFEAYWEVPYGAETAIGGQWRTGPGAKPFRAAEKELGELPFIAEDLGMITDAVHELREEL
GFPGMRVLQFGFATMEDDFHRPSTYPESCVAYTGTHDNDTVMGWYHLRTPPEEGDDPLDE
VVTSEHEVHWQLIDAVMSSAAEIAIVPIQDVLGLGNEARMNLPGIADGNWAWRLSPQALT
QEHADRLALLCQQRGRLTHEVPSVG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcccgcgatcctccggcattctttgtcacatcaccagtttgccttcggagttg
ggcatcggtgatctaggttcagcggcgtacgagatggtcgacttcctccatgcggccggc
caatcgatttggcaaattctaccgctcagtcctcccgcctatggcaactcaccctacagc
gcctactcggcgtttgggggcaacgcgttgttaatcagcttggaggctcttgtcgacgaa
ggtttgctcgaaacatccgacctcgacggattcacgcagaccgacccggcacgcgttgac
ttcggtacggtcagcgaattcaaacacgccagactcaaactcgcctacgaacgttaccta
accaagccaccacgtgaactgaagatcgccttcgagttgttcctggatgcgaacgattgg
tggctcgatgagttttccttgtttgaagttttcttgaacaagttcgaacaatcgaactgg
tcgaagtggcccgatccgatccgtcgtcgcgaacccgatgcacttggacaagctcgccaa
gagatgtcacgcgagatcgactattctcgcttccaacaattcttgttcgaccgccagtgg
aatcgactgaaggcgtatgccaatgagcggcaagtccaactgtgtggcgacatgccgatc
ttcgtcgcttacgaaagtgcagatgtctggggcaaccaagacatgtttgcattgaatgac
gatggcacgcccaagttggtcgccggcgtgccaccagactacttcagcgaaaccggtcaa
ctttggggcaaccctcaatacgattgggatgcacttgagaaggctgactacgcttggtgg
accgcgcgtttccgtcgttcgttggaacagtttgatctgctgcgagttgatcacttccgc
ggcttcgaagcttattgggaagttccctacggcgccgaaactgcgatcggcggtcagtgg
cgaactggtcccggcgctaaaccgttccgtgccgccgaaaaagaactcggcgaactccct
ttcatcgccgaagacctagggatgatcaccgatgcggtgcacgaactgcgtgaagagctc
gggttccccgggatgcgtgtactccagttcggattcgcgacgatggaagacgatttccat
cgcccgtcgacctaccccgaatcctgtgtcgcctacacaggcacccacgacaacgacacg
gtgatgggttggtaccatctgcgaacgccacccgaggaaggcgacgatcctctcgatgaa
gtcgtgaccagcgaacatgaagtgcattggcaattgatcgatgccgtcatgtcatcagcc
gctgaaatcgcaattgtccccattcaagatgtgctggggctgggtaacgaggctcgaatg
aatttgcctgggatcgccgacggcaattgggcgtggcgattgtcacctcaagcgttgacg
caagaacacgccgaccgtctcgcgttgttgtgtcaacaacgaggccgtctcacgcacgaa
gtccccagcgtcggctga

DBGET integrated database retrieval system