KEGG   Rhodopirellula baltica: RB4511Help
Entry
RB4511            CDS       T00134                                 

Definition
sensory transduction histidine kinase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rba  Rhodopirellula baltica
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rba02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rba02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2307911..2312824
Genome map
AA seq 1637 aa AA seqDB search
MADTKASQNISFGSETEDEDDSSTSSGTHQHVVGIGASAGGLEALEQLFGKMPVATGMSF
VVVQHLSPDFKSHMDDLLRRVTDIPVEVVDNGVEVQPDTIYLIPAKKEMVISNGKLLLTD
RGSEKILTHPIDQFLRSLAQDLRERAIGIVLSGTGSDGSRGVVEISNNGGLVVIQDPMTC
KFDSMPMNARNTGHVDMELAPDKMGEALQQYLFDGQRTKADQPINMGEIQRSGLERVFQL
LKKNHGINFHHYKSGTVHRRIQRRMDLLHLDTLTEYVAHINEHADEVNELYRDLLIGVTK
FFRDREAFSVLEQRVIPELIEKAKDTIRIWVCGCATGEEAYTIAMLMREGIEQSERHVDF
KMFATDPHRGSLQIAATGSYSEAQMSEVSLERRARFFTKRESGYVVKDELRRCVVFAAQN
VINDPPFTQMDLVSCRNMLIYLQSPAQRKTLSLFHFSLKANGILFLGPSESVGDIGDEFD
AINTQWKIFRKRRDVRLPIELRMPLANQSVSPVTPQTPSIVEPPPQRRNENLLEIYNVLL
ADKMPPSLVIDTDYRIIHVFPGANRYLTVPSGTPSDNILHMVPKELRASIGAAVTQAIKQ
QSAVHYQGIPSPVDGPDHVLELIVEPYHVPKLASSCVLIQFKASEMRTAFGDALTTSNES
TESEGTLLDFSTAAHSRIEDLEQELSFNRQNLQATIEELETSNEELQATNEEMVASNEEL
QSTNEELQSVNEELYSVNAELQVRVNEVNEANADMVNLLATTRVGVVFLDDDLRVRRVTP
EISRLLSIEPNDLGRSFESFIHPIQDDQFLERVRQARDERVELEWEVSCRDSSYLVRALP
YLRNSEINGVVIAFVDVDILRRAERDVLKFKFMADQNIDALVLLDQKGKISYANRKMCDQ
LGYSNEEILGQLLSRFKSETDPKSFDDRLEKAHAKGGNLFESWLQQRDGTEFPVEVALTP
VFLQGKQLLFASIRDISLRKTHESQMRLLSEAVQSAANGIVITDCSLEDHPISFVNKGFT
DMTGFSEQEILGRNCRFLQGEHTDNETVLRIRRALGRGESVRELIKNYRKNGEPFWNDLY
ITPVHDENGILTHFVGVQNDVTERIEAARQTETNERTIRLLLDSTAEGLFGLDVHGKCTF
SNEKAARLLGYEHGSQIVGKELAELAQPCDPNGNPFEKDSLQILGAVRAGEAINRYDERF
CRKDGESFPVEYWCHPIQEDGKIVGAVVTFVDIETRLQVENELREAKLAADAANEAKSHF
LANMSHELRTPLSAILGFTKILQEDPDEGTIQEYLSTIQRNGDYLLRLLGDVLDLSRIEA
NKFTTATSSVSLGELLADIFETMKMRTQDYQNTLHFDVSEPLPRTITTDSARLRQIMINL
IANAIKFTPKGRVEVVVRSEKIDDDSFLLLKVIDDGIGIADEKLRTLFEPFVQADATISN
RFGGTGLGLSITKRLTNALGGTIQVSSTEGEGSEFTIRLPVDPIGTMDQLTIELTDEKDN
DNSKSSLDQDIQLNARVLIADDMRDVRFVAQHFLKKAGCEVEVAENGRQAVDMVVAASRD
GKPFELCLMDMQMPELDGLGAVRELRQRGIELPVIALTADAMKGTRRRLITEGFDEYLSK
PLKVNRLLRIAKGLLDA
NT seq 4914 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaccaaagcttcccagaatatttcgttcggctcagaaaccgaggacgaagat
gattcttcgacctcgagcggaacgcaccagcacgtcgtcggcattggggcatcggccggc
ggactcgaagcactcgaacaactcttcggcaaaatgccggtcgcaacggggatgtccttc
gtcgtcgttcagcacctgtcgcccgacttcaaaagccacatggatgatttgctccggcga
gtcaccgacatcccggtcgaagtcgtcgacaatggagtcgaggttcagcccgacacgatc
tacttgatccccgccaaaaaggaaatggtcatcagcaacggcaagttgttgctgaccgac
cgaggaagcgaaaagatccttacgcatcccatcgatcaatttctgcgatcgctggcgcaa
gatctccgtgaacgagccatcgggatcgttctatctgggaccggcagcgatggatcccgc
ggcgtcgtcgagatcagcaacaatggcggattggttgtgatccaggatccgatgacatgc
aagttcgattcgatgccaatgaacgcccgaaacaccgggcatgtcgatatggaactggct
cccgacaaaatgggagaagctctgcaacaatatctcttcgatgggcaacggaccaaagcg
gatcagcctatcaacatgggcgaaattcaacgttcgggattggaacgcgtttttcaactg
ctcaagaagaatcatggaatcaacttccaccactacaaatcgggcacggttcatcgtcgc
attcagcgacggatggacttgttgcaccttgacacgctcactgagtacgtcgctcacatc
aacgaacatgccgacgaagtcaacgagctttatcgtgacctattgatcggcgttaccaag
ttctttcgtgatcgagaggctttcagtgttctcgaacaacgcgtcatccctgagctgatc
gagaaagcaaaagatacgattcgcatctgggtctgcggttgtgcaaccggcgaggaagcc
tacacgattgccatgttgatgcgtgaaggcatcgagcaatcagaacggcacgttgacttt
aagatgttcgccaccgacccgcaccgtggctcgttgcaaatcgcagcaacaggaagttat
tccgaagcccaaatgagcgaagtatcgctggaacgccgcgcacgctttttcaccaagcgt
gaatcgggctacgtcgtcaaggatgagcttcgtcgatgtgtcgtctttgcagctcaaaac
gtcatcaacgatccaccgttcacgcaaatggacctggtgtcttgcaggaacatgttgatc
tacctgcaatcgcccgctcaacgcaaaacactttcgctgtttcacttttctctgaaggcc
aatggaatcttgttcctgggcccgagcgaaagcgtgggtgatatcggcgacgagtttgat
gcaatcaacacgcagtggaagatttttcgcaaacgacgcgacgttcgcttgccgatcgag
ttgcgaatgccgctcgcgaatcaatcggtttcaccggtaacgccccagacaccttccatc
gtcgaaccgccaccgcaacggcggaatgaaaacctgctggagatttacaacgtcttgctg
gcggacaagatgccaccaagcttggtgatcgacacggactaccggatcattcatgtcttc
ccgggtgccaatcgatatctgactgttcccagcggcacaccatcggacaatatccttcac
atggtgccgaaggaattgcgtgcatcgatcggtgccgcggtcacgcaagcgatcaaacaa
cagagtgccgtccactaccaaggcatcccttcgccggtcgacggacccgaccacgttctg
gaactgatcgtcgagccatatcacgtcccgaagctcgcgtcctcgtgcgtgctgattcaa
ttcaaagcatctgaaatgcgcaccgcatttggtgatgcattgaccacaagcaatgagtcc
actgaatccgaaggcaccttgttggacttttcgaccgcggcacattcgcgaatcgaagat
ttggaacaggaactcagtttcaatcggcaaaacctgcaagccacgattgaagagctggaa
acttccaacgaagaattgcaagcgaccaacgaagaaatggtcgccagtaatgaagaactt
caaagcaccaacgaagaactgcagagcgtcaacgaagagttgtactcggtcaacgcggag
cttcaagttcgtgtgaacgaagtgaatgaagcaaacgccgacatggtcaacttgttggca
acaactcgtgttggcgtcgtgttcttggacgacgacctccgcgttcgtagggtcactcct
gaaatctctcgtttgctttcgatcgaaccaaacgacctgggacgctcctttgaatccttc
attcaccctatccaagacgaccagtttcttgaacgcgtacggcaagctcgcgatgagcga
gttgaattggaatgggaagtcagctgtcgcgattcttcctacttggtccgcgcccttccg
tatctgcgaaactctgagatcaacggcgtcgtcatagcgtttgtggacgttgacattcta
cgccgtgccgaacgcgacgtattgaagttcaagttcatggcggaccagaacatcgacgca
ttggttttgctcgatcaaaaaggaaagatcagctacgccaatcgcaagatgtgcgatcaa
ctgggttactcaaacgaagaaatccttggacaactactttcccgtttcaaatcagaaacc
gaccccaaatcgttcgacgatcggctcgagaaagctcatgcgaaaggtggcaatcttttt
gagtcttggcttcaacaacgcgacggaacagagttccccgtcgaggttgcgctaacgcca
gtcttcttgcagggcaaacagcttttatttgcatcgatccgcgatatttctcttcgcaag
acccatgaatcgcagatgcgattgctcagcgaagcggttcagtcggctgccaacggaatt
gtcatcacggattgctccttggaagatcacccgatctcgtttgtgaacaaaggcttcact
gacatgactgggttctccgagcaagagatcctcggtcgcaattgtcgattcttgcaagga
gaacacaccgacaacgaaaccgtcctgagaatccgacgggctcttggccgtggtgaatcg
gttcgcgaactgatcaagaactatcgcaaaaatggcgagccattttggaacgatctctac
attaccccggttcacgatgaaaacggcatcctgactcattttgttggtgttcaaaacgat
gtgaccgaacgcatcgaagcggctcgccaaacggaaaccaacgaacggaccattcgattg
ttgctggattcgaccgccgaaggtttgtttggtttagacgttcacggcaaatgcactttc
agcaacgaaaaagcagcccgactgctgggctacgaacacggcagccagatcgttggcaag
gaactcgcggaactcgcgcaaccctgcgatcccaatggaaatccgtttgagaaagattct
ttgcaaattctcggtgcggttcgtgctggcgaagcgatcaaccggtacgacgaacgtttt
tgtcgcaaagatggcgaaagcttcccggttgaatattggtgtcatccaatccaagaggac
gggaaaattgtcggagccgtggtgaccttcgtcgatatcgaaacccgactgcaggtcgag
aacgaattgcgagaagcaaagctggcagccgatgctgctaacgaagcgaagagtcacttc
cttgccaacatgagtcacgagctgcggacgcctctatcggccatccttggtttcaccaaa
atccttcaggaagatcccgacgaaggcaccatccaagaatacttgtcaacgatccagcga
aacggagattacctgctccgtctgctcggcgacgtcctcgacctgtcacggatcgaagcg
aacaaattcaccaccgcgaccagcagcgtctcattgggtgaactcctggccgacattttc
gaaacaatgaaaatgcgaacccaggactaccaaaacacactgcactttgacgtcagcgaa
ccacttccaaggacaatcacaaccgactccgcgcggctacgtcaaatcatgatcaacttg
attgccaacgcgattaagttcactccgaagggccgagtcgaagtggtggtgcgatccgaa
aagatcgacgacgactctttcttgttgttgaaagtcatcgatgacggaatcgggattgcg
gacgagaaattgcgaacgctgtttgagccgttcgtccaagcggacgcgaccatctcaaat
cgctttggcggcaccggactgggactcagcatcaccaaacgcctcaccaatgcgttgggt
gggacgatccaagtcagcagtaccgaaggcgaaggaagcgagttcactatccgattgcca
gtcgatccgattggcaccatggaccagctgacgatcgaattgacggatgaaaaggacaac
gacaattccaagtcatcactcgaccaagacatccagctcaacgcacgagttttgattgcg
gatgacatgcgagacgttcgcttcgtggcccaacactttttgaagaaagcgggctgcgaa
gtggaagttgctgaaaacggaaggcaggccgtcgacatggtcgtggcggcgagcagagat
ggtaagccgttcgaactttgcctgatggacatgcagatgcccgaactggatggactgggg
gccgtgcgagaacttcgccaacgagggatcgagttgccggtgatcgcgttgacggctgat
gcaatgaagggcacccgtcgccgtctgatcactgaaggctttgacgagtacttgagcaaa
ccgttgaaggtcaaccgtttgctacgcatcgcgaaaggtttgctagacgcctga

DBGET integrated database retrieval system