KEGG   Rhodopirellula baltica: RB4561Help
Entry
RB4561            CDS       T00134                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rba  Rhodopirellula baltica
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RB4561
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RB4561
Enzymes [BR:rba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RB4561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2333282..2335552
Genome map
AA seq 756 aa AA seqDB search
MRRTFISFRRARFVLSQSILQLASKSLDTIYRYDPKFVFASLIPHPKLNRLPMLVRCLLA
YLLLASTTFIAAAEVSIVPLPAKVEPGDGANLILPSMITVESPPISGWSDHLEIFGEHLE
RMTAGKHQLQTSDANNPVLLISHTPNLSPEAYTLSITQKQIQIEASSIKGFAHSTATLLQ
LIGGSRSDSIPPMRIEDAPKLSYRNFMIDMGRNPHSLALLKEAIDLLWFYKIDSVQLHLT
DDQRIAFPSTAFPKLWDGKITLPEFKELERYAVQRGVTIIPELEVPGHSELLRRNYPEVF
GKTGTDLTKSPKAIEGIKTLLDEMIAVFSSSPYIHIGGDEAFGVPENLQRDLINELHAYL
KTRGKETLVWEGPAPGSGDNRVHPEVIHLNWRTINYPADQMVKNGHRVINASWDPLYLVD
HYPRTNFTMTSPQHIYETMSLTKFKHVNPQIQTYANPIEVDSTDKLIGFCMPWWEGREEN
FVQQTFPRLIPFAEVAWNPDTKRDYQNFQQRTSQTELARIAAFYPVSIETTRMLVPDDGI
FDRSTQVTLQLPNVSGASSQSGVEIRYTTDGSEPTKDSTVYQRPFTLTDNATVRATAFIG
DSSIGHGSRQNLTMVDSQANLALHKPVTSSTTSGSPFSVERITDGGTNNLGFYLGYPADP
EPILLTIDLEDVQSVEQVKVFAYSIAGSFEKYSIETSVNGVDFEEVASRMEKPADPTSPV
EHRFTARQVRYVRIRTHGNKGYVFDSFSKIVEVQVF
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
ttgaggcggacattcattagcttcaggcgagctcgctttgttctttcgcaaagcattctg
caacttgcctcaaaatcactcgacacgatctatcgatacgaccccaagtttgtatttgca
tccctgatcccacatccaaagttaaatcgattgcccatgctcgttcgttgccttctcgcg
tacctgctccttgcctcgaccactttcattgccgcggccgaggtttccattgttccattg
ccggccaaggtcgaaccaggcgacggcgcgaacctaattctgccaagcatgatcaccgtc
gagtcgccgcccatttcgggctggagcgatcatctggagattttcggcgagcatctcgaa
cgcatgaccgccgggaagcatcagttgcaaacttccgacgcgaacaatccggtgcttctg
atatcgcacacaccaaacctgtctccggaagcctacacgctttcgatcactcaaaagcaa
atccagatagaagcctcgtcaatcaagggcttcgctcactccaccgcgacacttctgcaa
ctgattggcggaagccgatcggattcgattcctccgatgcgtatcgaagacgcacccaag
ttgtcatatcgcaattttatgatcgacatgggacgcaaccctcacagtctcgcgttgttg
aaggaagcgatcgacctgctctggttctacaaaatcgattcagtgcaactgcacctcact
gatgaccaacgcatcgcctttccgtccaccgcctttcccaaactgtgggacggaaaaatc
acactgcccgaattcaaagaactcgaacgatacgcggtccaacgaggcgtgacgatcatt
cccgagttagaagtccccggccactcggaattgctacgacgcaactatcccgaggtcttt
ggcaaaacgggaacggacctgacaaaatcacccaaagccatcgaaggcatcaaaactttg
ttggacgagatgattgcggttttctcttcctcaccctacatccatatcggtggcgacgag
gcgtttggcgttcctgagaatctgcagcgtgatctgatcaatgaattgcacgcttacttg
aagactcgaggcaaggaaactttggtttgggaaggccccgccccaggctcaggcgacaac
cgagtccatccggaagtgattcatctgaattggcgaacaatcaactatcccgccgaccag
atggtcaagaatggacatcgtgtgatcaacgcttcctgggatccgttgtacttggtcgat
cattatcctcgcaccaatttcacgatgacttctcctcagcacatctatgaaacgatgtcg
ctaacgaagttcaaacatgtgaatccacaaatccaaacgtacgcgaatccaatcgaggtt
gattccaccgacaaactcatcggcttctgcatgccatggtgggaaggtcgcgaagagaac
ttcgttcagcagacctttccacgcttgatcccatttgccgaagtcgcatggaaccccgac
acgaaacgcgattaccagaactttcaacaacgcacgtcgcaaaccgaacttgctcgcatt
gccgcgttctatccggtttcgatcgaaacgacccgaatgctcgtccctgacgatggcatc
ttcgatcgatcgacgcaggtgacacttcaattgccgaacgtcagcggtgcctcctcccaa
tcgggcgtcgagatccgctacacaactgatggttcggaaccaacgaaagattcgactgtc
taccaacgaccattcacgctaaccgacaatgcgaccgttcgcgcgaccgcattcatcggc
gattcgtcgattggccacggcagcagacaaaatctgacgatggtggacagccaggctaac
ctcgcgttgcacaaaccggtcacctcgagcacaacctcaggctctccattttcagtcgaa
agaatcaccgatggcggcacaaacaacctcggcttttatctgggttatcctgccgatccg
gaaccaatccttctgacgatcgatttggaagacgttcagtcggtcgagcaagtcaaggta
ttcgcctacagcattgcgggctcgtttgaaaagtacagcattgaaacatccgtcaatgga
gtcgactttgaggaggtagcgtctcgaatggagaagcccgcagatcccacttctccggtc
gagcatcgttttactgcacgccaagttcgctatgttcgtatccgaacgcatggcaacaag
ggttacgttttcgattcgttctcaaaaatcgtcgaagtgcaagtcttctga

DBGET integrated database retrieval system