KEGG   Rhodopirellula baltica: RB4606Help
Entry
RB4606            CDS       T00134                                 

Definition
protein disulfide-isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
rba  Rhodopirellula baltica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2359956..2360591)
Genome map
AA seq 211 aa AA seqDB search
MCLCLTRGNLMAQSVVAGSNRICGTGDDRQSVSPRIGRCVSFLFRFSYGWRMAAMTAFIG
LFSSTASAEMPIIGKVVSSLSASKVARPSATELVSADTPMWHDDFDSGWAAARRSGRPML
IFITSEDCRFCDAMKQNTFCDASIRSRLANGFVPIILRPDTNPNILARIPVTTYPTTLLA
VPRGKVIAHRVGYQPPDRLHELLGLAPSSPN
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtctttgccttacgaggggaaatctcatggctcagtcagtggttgcgggaagcaac
cggatttgcggaaccggcgatgatcgccaatctgtttcgccgcgtatcggacgatgcgtt
tcttttctttttcggtttagctatggatggcggatggcggcgatgaccgcattcattggg
ctcttctcatccaccgcaagtgccgagatgcccatcatcggcaaggtggtttcgagtttg
tctgcatcgaaagtggctcgaccgagtgccaccgagcttgtttcggcagacacgccaatg
tggcacgatgattttgactcgggatgggctgccgctcggcgttctgggcgaccgatgctg
attttcatcacgtcagaggattgtcgcttttgcgacgcgatgaaacaaaacactttctgc
gatgcgagcatccggtctcgactcgccaatggttttgtgccgatcatcctgcggcccgat
acgaatccgaatatcctggctcggattccagtgaccacttatccgacgacattgttagcc
gttccgcgcggcaaagtgatcgctcaccgagtaggctatcagccacctgaccgactccat
gaactgctggggttggctccttcctctccgaactga

DBGET integrated database retrieval system