KEGG   Rhodopirellula baltica: RB4610Help
Entry
RB4610            CDS       T00134                                 

Gene name
ruvA
Definition
holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rba  Rhodopirellula baltica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RB4610 (ruvA)
Enzymes [BR:rba01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RB4610 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2360999..2361622)
Genome map
AA seq 207 aa AA seqDB search
MIVSIAGKLVQVGEISVIIQAAPFDYEVYVGDYTRRQLQNQIGNEVRLHTLDYIEGNAQG
GRLTPRLIGFSTLPERQFFDLFCSVDGVGVKKALRAMVRPVKELAVLIEEQDAKTLSALP
GIGPATSEKVIAKLRRKMPRFALMVAGGEVADAMEVESPIVSDTYDALVTLGHSESDARK
LIDETLATGKKFKDTESLLTAIYQRSK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtttcgattgctggcaaactggtccaagtgggcgagatcagtgtcatcatccag
gcggccccgtttgactatgaagtctacgtgggcgactacacccgccggcagttgcaaaac
cagatcggcaacgaagttcggttgcacacgctggactacatcgagggcaacgctcaaggc
ggacgcctcactccgcggctaatcggattttcaacgctacccgagcgacagttctttgac
ctgttctgcagtgtcgatggtgttggcgtgaagaaggctcttcgggcgatggttcgaccc
gtcaaagagctcgccgttttgattgaagagcaagacgcgaaaacgttgtcagcgcttccc
ggcatcggaccggcaaccagcgaaaaggtcatcgcgaaactgcgtcgcaaaatgcctcgt
ttcgcgttgatggtcgctgggggagaagttgccgatgcgatggaagtcgaatctccaatc
gtttcggatacctacgatgcattggtcacgctggggcactccgagtcggatgctcgtaag
ttgatcgacgaaacgttggcaacgggcaagaagttcaaagacaccgagtccttgctcacc
gcaatctatcagcggtccaagtaa

DBGET integrated database retrieval system