KEGG   Rhodopirellula baltica: RB5256Help
Entry
RB5256            CDS       T00134                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rba  Rhodopirellula baltica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RB5256
Enzymes [BR:rba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RB5256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2708872..2710458
Genome map
AA seq 528 aa AA seqDB search
MVLSVFLMISPRVKMFVRTTDVGLRPLRWLPAVMLAAIGIVGASLSDASAQTALGEKVLF
GESPLTDIQITSQDAKIEPVPNALMKVTVPPSNGYPNVQWNVTGTPLRLDAFDALETEVF
NPGNQSVKVVLTARNPGSSGRDGSSAAAATVPPNSSGVIRVAFGTWHGQTDVPFDAARIQ
SVAVIIEKPTDQSSITIQSIRAVSESRLLEQLKTTAFFQNQTPFFGRGVNIGNALEAPRE
GDWGPRLEAKHLDLIQQAGFDSVRVPVRWSTHASNTAPYTISSTFMKRVRWVVDEALRRD
LKVMINIHHYEGLYANPEQHHDRFLELWRQIANEFEDAPPELVFEVLNEPHENLDAGKWN
RLLADALPIIREKHPTRTIVVGPANFNSIDALQFLKLPKDRQNLVATFHYYSPFQFTHQD
AGWLGDESKQWKGTTWTGTPEQQKAVRNDLDRALRWSVENEVPIYLGEFGAYQAADMESR
IQWTRFVADEAIERRIGIAYWEFYSGFGIYDPKQQQWHEGLRDAILGK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtggtcctatccgtgtttctcatgatttcccctcgagtaaaaatgttcgttcgtaccacc
gatgttggtcttcgtccgctgcgttggctgcctgccgtgatgctcgccgcgattggaatc
gtcggggctagcttgagcgacgcttccgctcaaaccgcgttgggtgaaaaagttttgttt
ggggagagtccactcactgacatccaaatcacttcgcaggatgcgaagatcgaaccagtc
cccaacgctttgatgaaagtcacggttccgcccagcaatggctatcccaatgtgcagtgg
aatgtcaccggaacgccgctccgcttggacgcgtttgatgccctggagaccgaagttttc
aaccccggcaaccaatcggtcaaagtcgtgctgacggcacgcaaccctggatcgagcggt
cgcgatggcagcagcgcggctgcggcaacggtaccacccaattcatctggagtcatccgt
gtcgcgtttgggacttggcatggacaaaccgacgttccctttgacgcagcccgaatccaa
tcggtggctgtcatcatcgagaaaccaaccgatcaaagctcgatcacgatccaaagcatc
cgagcggtcagcgaatctcgtttgctggaacaactgaagaccaccgcgttctttcaaaac
caaacgccgttcttcggccgaggcgtgaacatcggcaacgcgttggaggctcctcgcgaa
ggcgattggggcccgcgactggaagcaaaacacttggacctgatccaacaagccggtttt
gattcggttcgagtgccagttcgctggtcgacacatgccagcaacaccgccccttacacg
atcagctccaccttcatgaagcgggttcgttgggtggtcgacgaagcgttacgccgcgat
ctcaaagtgatgatcaacatccatcattacgagggcttgtacgccaatccggaacagcat
cacgatcggttcctcgaactgtggcgtcagatcgcgaacgaattcgaggatgctccgccg
gaactggtattcgaagttttgaatgaaccacacgaaaatctcgacgccggcaaatggaat
cgcctgttggcggacgctctcccaatcattcgcgaaaaacatcccactcgaacgatcgtg
gttggaccagcgaacttcaattccatcgacgcgttgcagtttctcaaactcccaaaagat
cgtcaaaacttggtcgcaacgttccactactactcgccgtttcagttcactcaccaagac
gcgggatggttgggtgacgaatccaaacaatggaaaggcaccacctggactggaacgccc
gaacagcaaaaggccgtccgcaacgatcttgatcgagctctccgctggagcgttgaaaac
gaggtccccatctacctcggtgagtttggtgcctaccaagccgccgacatggaatcacga
attcagtggacgcgttttgtcgccgacgaagcgatcgagcgaagaatcggaatcgcctac
tgggagttctactcagggtttggaatctacgatccgaaacaacaacaatggcacgaaggc
ctacgcgacgcgatcctcggaaagtag

DBGET integrated database retrieval system