KEGG   Rhodopirellula baltica: RB5320Help
Entry
RB5320            CDS       T00134                                 

Definition
(RefSeq) zinc-type alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
rba00010  Glycolysis / Gluconeogenesis
rba00071  Fatty acid degradation
rba00350  Tyrosine metabolism
rba00625  Chloroalkane and chloroalkene degradation
rba00626  Naphthalene degradation
rba01100  Metabolic pathways
rba01110  Biosynthesis of secondary metabolites
rba01120  Microbial metabolism in diverse environments
rba01130  Biosynthesis of antibiotics
rba01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB5320
  Lipid metabolism
   00071 Fatty acid degradation
    RB5320
  Amino acid metabolism
   00350 Tyrosine metabolism
    RB5320
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RB5320
   00626 Naphthalene degradation
    RB5320
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RB5320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C PCMT AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 1794563
NCBI-ProteinID: NP_866632
UniProt: Q7US13
Position
2747272..2748462
Genome map
AA seq 396 aa AA seqDB search
MLCTLKTSLKRDSKLSVITRSVSKRWSCPELHATALGLSDVPTQPFYRQSTGNPMQSAAV
VNYAPEPGSVEIREIDRPEIGSQDVLLEVSHVGVCGSDLHQWTAHHSWPVNYPVVLGHEF
GGHIVQLGSDVEGWKEGDRVVSETAAIIDSNNPMSRRGLYNLDPTRKGFGYGVNGAMTRY
VRVPSRILHEVPHSLAFEHACLTEPCCVAYNAVVRNARIEPGDRVIVMGPGTIGILCAAM
ARLCGAEVALVGLESDRHRLNIAEENYGCQGIVGDPTDWANQRDGLGCDGVIDAAGSSVT
LEIAMQVVRPAGWISKVGWGPQPLGYNLDPLVQKNVTLQGSFSHNWPIWERVLALLTSGQ
LNVAPIIGGIWPIDQWQTAFDKMHRGEVVKSVLQPI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcacgctcaagacgtcgcttaaaagggacagcaagctctctgtcataacccgc
agcgtaagcaagaggtggagttgccccgaactccacgcgactgctcttggattatcagac
gttccgactcaacctttctatcgtcaatcaacaggcaatcccatgcaatccgctgcggtg
gtgaactacgctcccgaaccaggctccgtcgaaattcgcgaaatcgatcgtccggagatc
ggctcgcaagatgtgctgttggaagtgtcacacgtgggagtctgcggcagcgatcttcat
cagtggaccgcacaccattcatggccggtgaactaccccgtggtgctgggacacgagttt
ggcgggcacatcgtgcagcttggtagcgatgtcgaaggttggaaagaaggcgaccgcgtg
gtcagcgaaaccgccgcgatcatcgattccaacaatcccatgtcacggcgaggcctctac
aacctggaccccacacgaaaagggtttggctacggagtcaatggtgcgatgactcgctat
gttcgcgttccgtcgcgaattcttcatgaggtccctcattcgctcgcatttgaacacgcg
tgcctgaccgaaccctgctgcgtcgcttacaacgccgtcgttcgcaatgcacgcattgag
ccgggtgatcgagtcatcgtgatggggcccgggaccattggcattttatgcgccgccatg
gcgcggctttgcggtgccgaggtggctttggttggactggagtccgatcgtcatcgtttg
aacatcgcggaagaaaactacggctgccaaggcatcgtcggtgatccaaccgattgggcc
aaccaacgcgacgggctgggatgcgacggcgtgatcgatgccgctggatccagcgtcacg
cttgaaattgccatgcaagttgtccgtcctgcgggatggatcagcaaagtcggctggggt
ccacaaccactcggatacaacttggatccgctggtccaaaagaacgtgactttgcaagga
agcttcagccacaactggccgatctgggaacgcgtgctggcgttgctcaccagcggacaa
ctgaacgttgccccgatcatcggcggcatctggccaatcgaccaatggcaaaccgcattt
gacaaaatgcaccgtggcgaagtcgtgaaatctgtgctccaacccatttaa

DBGET integrated database retrieval system