KEGG   Rhodopirellula baltica: RB5320Help
Entry
RB5320            CDS       T00134                                 

Definition
zinc-type alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RB5320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB5320
  Lipid metabolism
   00071 Fatty acid degradation
    RB5320
  Amino acid metabolism
   00350 Tyrosine metabolism
    RB5320
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RB5320
   00626 Naphthalene degradation
    RB5320
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RB5320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2747272..2748462
Genome map
AA seq 396 aa AA seqDB search
MLCTLKTSLKRDSKLSVITRSVSKRWSCPELHATALGLSDVPTQPFYRQSTGNPMQSAAV
VNYAPEPGSVEIREIDRPEIGSQDVLLEVSHVGVCGSDLHQWTAHHSWPVNYPVVLGHEF
GGHIVQLGSDVEGWKEGDRVVSETAAIIDSNNPMSRRGLYNLDPTRKGFGYGVNGAMTRY
VRVPSRILHEVPHSLAFEHACLTEPCCVAYNAVVRNARIEPGDRVIVMGPGTIGILCAAM
ARLCGAEVALVGLESDRHRLNIAEENYGCQGIVGDPTDWANQRDGLGCDGVIDAAGSSVT
LEIAMQVVRPAGWISKVGWGPQPLGYNLDPLVQKNVTLQGSFSHNWPIWERVLALLTSGQ
LNVAPIIGGIWPIDQWQTAFDKMHRGEVVKSVLQPI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcacgctcaagacgtcgcttaaaagggacagcaagctctctgtcataacccgc
agcgtaagcaagaggtggagttgccccgaactccacgcgactgctcttggattatcagac
gttccgactcaacctttctatcgtcaatcaacaggcaatcccatgcaatccgctgcggtg
gtgaactacgctcccgaaccaggctccgtcgaaattcgcgaaatcgatcgtccggagatc
ggctcgcaagatgtgctgttggaagtgtcacacgtgggagtctgcggcagcgatcttcat
cagtggaccgcacaccattcatggccggtgaactaccccgtggtgctgggacacgagttt
ggcgggcacatcgtgcagcttggtagcgatgtcgaaggttggaaagaaggcgaccgcgtg
gtcagcgaaaccgccgcgatcatcgattccaacaatcccatgtcacggcgaggcctctac
aacctggaccccacacgaaaagggtttggctacggagtcaatggtgcgatgactcgctat
gttcgcgttccgtcgcgaattcttcatgaggtccctcattcgctcgcatttgaacacgcg
tgcctgaccgaaccctgctgcgtcgcttacaacgccgtcgttcgcaatgcacgcattgag
ccgggtgatcgagtcatcgtgatggggcccgggaccattggcattttatgcgccgccatg
gcgcggctttgcggtgccgaggtggctttggttggactggagtccgatcgtcatcgtttg
aacatcgcggaagaaaactacggctgccaaggcatcgtcggtgatccaaccgattgggcc
aaccaacgcgacgggctgggatgcgacggcgtgatcgatgccgctggatccagcgtcacg
cttgaaattgccatgcaagttgtccgtcctgcgggatggatcagcaaagtcggctggggt
ccacaaccactcggatacaacttggatccgctggtccaaaagaacgtgactttgcaagga
agcttcagccacaactggccgatctgggaacgcgtgctggcgttgctcaccagcggacaa
ctgaacgttgccccgatcatcggcggcatctggccaatcgaccaatggcaaaccgcattt
gacaaaatgcaccgtggcgaagtcgtgaaatctgtgctccaacccatttaa

DBGET integrated database retrieval system