KEGG   Rhodopirellula baltica: RB548Help
Entry
RB548             CDS       T00134                                 

Gene name
glgB
Definition
(RefSeq) 1,4-alpha-glucan-branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rba  Rhodopirellula baltica
Pathway
rba00500  Starch and sucrose metabolism
rba01100  Metabolic pathways
rba01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RB548 (glgB)
Enzymes [BR:rba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RB548 (glgB)
Exosome [BR:rba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RB548 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_48 Alpha-amylase_C AMPK1_CBM Malt_amylase_C FAD_binding_1
Motif
Other DBs
NCBI-GeneID: 1795129
NCBI-ProteinID: NP_863971
UniProt: Q7UYJ7
Position
complement(304329..306230)
Genome map
AA seq 633 aa AA seqDB search
MSFAMVDSLRRTVAQRLIVIEGREMEQTALLDGMEENATEQSSVTKSGMGAIVHDDGVAF
RVWAPNADSVSVLGTFNQWKEDATPLKREEHGTWYVDVADAKAGDEYKYRIIRGDKSYDR
IDPYAREVTNSIGNAVVYADTFDWKHPTFDRPAQNELVIYEMHIGTFHRDDPDQPGTFSD
AVAKFKHLKELGVNAIQIMPVAEFAGDLSWGYNPAHIFAVEQAYGGPDALKAFVDAAHEA
GFAVIIDVVYNHFGPSDLDLWQFDGWSENDKGGIYFYQDHRSNTPWGDTRPDYGRGEVRQ
FIHDNAMMWMREYHADGLRYDMTAYIRTISGIGDDDIAEGWGLMQWINRDLRNEFPGCYL
IAEDLQTNNWLTKTEDQGGAGFTTQWDAAFVHPIRSAVQEIDDAHRDMWAVRDALCHRYN
GDAFQRVIYSESHDEVANGKSRVPSEIDAEDPESRFAKKRTILAAALALTAPGVPMLFQG
QEMLEDDWFEDTDPLEWERTRRLKGIKRLFRDLIHLRLNNDGLSKGLTGQHIVMHHVNEN
DKVVAFVRRAEDPQDDVVVLANFANRSWDQYEIGFPDSGDWQLKLNTDWSGYDQDFDDHP
VEHVDATEQPYDGLAARAEVSFGAYAVLVYTRK
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
ttgagttttgcgatggttgattcgctgcgccggacagttgctcagcgtttgatcgtcatt
gaagggcgtgagatggaacagactgcgttattggatggaatggaagagaatgcgactgaa
cagtcgtcagtcaccaagtcaggaatgggggccatcgttcatgacgacggagttgcgttc
cgagtctgggcacccaacgcagacagcgtgagtgtgctgggcacgttcaaccaatggaaa
gaagacgccacgccgctgaagcgagaagagcacggcacgtggtatgtcgacgttgccgat
gccaaagcgggtgacgaatacaagtatcgaatcatccgaggcgacaagtcctatgatcgc
atcgacccgtacgcccgcgaggttaccaattcgatcggcaatgcagtcgtctacgcagac
acatttgactggaagcacccgacctttgatcgaccggctcagaacgagttggtgatctac
gagatgcacatcggaacgtttcatcgagacgatcccgatcaaccgggaacgttctccgat
gcggttgcgaagttcaagcacctgaaagagctcggtgtcaatgcgattcaaatcatgccg
gtcgccgagttcgccggggatttatcgtggggctacaacccggcgcacatctttgcagtc
gaacaagcctatggcgggccggacgcgttgaaagcgttcgtcgacgcggcacatgaagct
ggctttgcggtgatcatcgacgtggtttacaaccactttggtcccagcgatttggatttg
tggcagttcgatggttggagcgagaacgacaagggtggcatctacttctatcaagaccac
cggtccaacacgccttggggcgacacgcgacccgactatggtcgcggtgaagtgcgtcag
ttcatccacgacaacgcgatgatgtggatgcgggaataccatgccgatggcttgcgttat
gacatgaccgcctacattcgcacgatctccggtatcggggacgacgacatcgcggaaggt
tggggattgatgcagtggatcaatcgtgatttgcggaacgagttcccgggctgctacttg
atcgcggaagacctgcaaaccaacaactggttgaccaagacggaagatcaaggcggtgcc
ggttttacaacccagtgggacgcggcgtttgtccatccgatccgatcggcggtgcaagaa
attgatgatgcgcatcgagacatgtgggcggtgcgagacgcgttgtgtcaccgatacaac
ggagacgctttccagcgagtgatctacagcgaatcacatgatgaagttgccaacggcaag
tctcgcgttcccagcgagattgatgcggaggatcctgaaagtcggtttgcgaaaaaacgg
acgatcctggcagcggctctggcactgacagcaccgggagttccgatgctgtttcaaggc
caagagatgttggaagacgattggtttgaagacactgatccgctcgagtgggaacgaact
cgccgactcaaaggcatcaagcgtctgttccgcgacctcattcacctgcgtttgaacaat
gacggtttgtccaagggattgacggggcagcacatcgtgatgcatcacgtcaatgaaaat
gacaaggtcgtcgcgttcgtgcggcgtgcggaggatccgcaggacgacgtcgttgtgctg
gccaacttcgccaatcgttcatgggaccaatacgaaatcggttttcccgattcgggcgat
tggcaattgaagctcaacaccgattggtccggctacgatcaagacttcgacgatcatccg
gtcgaacatgttgatgcaacggaacaaccgtacgacggtttggcagcgagagccgaagtg
tcgttcggtgcttacgcggttctggtgtacacgcggaagtga

DBGET integrated database retrieval system