KEGG   Rhodopirellula baltica: RB5560Help
Entry
RB5560            CDS       T00134                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rba  Rhodopirellula baltica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RB5560 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RB5560 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RB5560 (trpA)
Enzymes [BR:rba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RB5560 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2893360..2894241
Genome map
AA seq 293 aa AA seqDB search
MRPVPSAHPDADPPSMTPLQSLFESLRGQNRKALMPFLTTGDPNIDTTEAVIAAARQAGA
DLCEVGVPYSDPIADGPVIQASYQRALDAGFKLQHVWDLGQRLTENPKVKAMPRVTMVSY
SIIYRIGMAKYVDQAMQAGYCGAIVPDLLVEEAEDLSKICREKGFDLIQLVTPTTTRDRQ
CRIAELSSGFLYYVSVTGITGERTALPTNLVDNVGWLREQTELPICIGFGISGPETAAQL
APVSDGLIVGSAIVRRVADAVEKAKSSGADPVKTAAEEAGDFCHSLRQAIDAA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgagacctgttccgtccgcccatcctgacgccgatccgccatccatgacgcctctgcaa
agcctgtttgaatcccttcgtggtcaaaaccgcaaagccttgatgccgttcctgacgact
ggcgacccaaacatcgatacgacggaagcggtgatcgcggcagcacgccaagccggggca
gatttatgcgaagtcggtgtcccctacagcgacccgattgcggatggcccggtcatccaa
gcgtcttaccaacgagcactcgacgcaggattcaaacttcaacacgtttgggatctgggt
caacgtctgaccgaaaatcccaaagtcaaagcgatgccgcgtgtcacgatggtcagctac
tcgatcatctaccgaattggcatggccaagtacgtcgaccaggcaatgcaagccgggtac
tgcggcgcgatcgtgcctgatttgttggtcgaagaagcagaggatctgagcaaaatctgc
cgtgagaagggatttgatctgatccaactggttacaccgaccacaacccgagaccgccaa
tgccgcatcgcggaattgtccagcggatttctgtactacgtttccgtgaccgggatcacc
ggtgagcgaaccgccttgccgaccaacttggtggacaacgtcggatggctgcgtgagcaa
actgaattgcccatctgcatcggttttggaatcagcggtccggaaacggccgcacaactc
gcacctgtttctgatggcctgatcgtcggctcagccatcgtccggcgtgtcgccgacgcg
gtcgaaaaggcgaagagctccggagctgatccggtcaagacggccgcagaagaggccggt
gatttctgccattcattgcgacaggcaatcgacgcggcataa

DBGET integrated database retrieval system