KEGG   Rhodopirellula baltica: RB5813Help
Entry
RB5813            CDS       T00134                                 

Gene name
phoD
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rba  Rhodopirellula baltica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rba00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rba00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rba02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3047192..3048607
Genome map
AA seq 471 aa AA seqDB search
MMLSRLALVILASLVCSSAVQAQRYFLGQGVMSGEVTSTSVLLQTRLTAREGLDESGDLP
GRAGRVRFEWSTAPDFRSSQTSDQLIAEPGHDFIVRHLVTSLTPGTRYYYRALVSVATEE
RPFEPIGQFQTLPAEDSEADVEFLVFSCMNYNKFLHGKKAKSSGPLTATEEDKRLGYPAL
VHMKKHSPAFFVGTGDIVYYDNPYRNAETLTQLRQCWHEQFRFPRLIDFLKEVPGYWSKD
DHDFRFNDSDHDKDRLPLPNTGIQVFREQLPIVPADDQDSPTYRTFRVNQHLQIWLTEGR
DYRSPNRMKDGPEKTLWGDEQKQWLKSTLKASDAKWKLLISPTPLIGPDDAYKKDNHANL
KGFRHEANEFFEWLDANEIDHFMTMCGDRHWQYHSIHPSGIQEFACGALNDENSRMGVPP
GSRRGTDPEALIEQPFISPEPSGGFLSVTAGEDLLVEFYNDEGKLLYEARP
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatgctatcacgtcttgctctggtcatcctagcgtcgcttgtctgctcatctgcggtt
caagcacaacggtatttcctaggccaaggcgtgatgtccggtgaagtcacctcgactagc
gtgttgctgcaaacgagactgaccgcgagagaagggttggacgaatccggcgacttgccg
ggtcgcgcaggaagagtacgtttcgaatggtccaccgccccagattttcgatcgtcgcaa
acgagcgaccagttgatcgcggaacctggccacgatttcatcgttcgccacctggtcacg
tcgctcactcccggaacgcgttactactatcgagcattggtttccgtcgcgaccgaggaa
cgcccgttcgaaccaatcgggcaattccaaacgctcccggccgaagactccgaggccgat
gtcgagttcctggttttcagttgcatgaactacaacaagttcctgcacggcaagaaagcc
aagtcatccgggccactgactgccacggaagaggacaagcgactgggttatccggcgttg
gtccatatgaaaaaacattcgccagctttcttcgttggtaccggcgacatcgtttactac
gacaatccctatcgaaatgcggaaaccttgacgcagcttcgacaatgctggcacgaacag
ttccgtttccctcgcctgatcgatttcctgaaagaagtcccggggtattggtccaaagat
gaccatgactttcgattcaacgattcggaccacgacaaggatcgtctgccgcttcccaac
accggaattcaagtctttcgagaacaactgcccatcgttcccgcggacgatcaggattca
ccaacctatcgcacttttcgtgtcaaccaacaccttcaaatttggttgacggaaggtcgt
gactaccgatcacccaatcgcatgaaggatggaccggagaagacactgtggggcgacgag
caaaagcaatggctcaagagcacactgaaagcaagtgacgcgaaatggaagttgttgatc
tcgcccactcctttgatcggccctgacgatgcctacaaaaaagacaaccacgccaatttg
aagggatttcggcacgaagcgaatgagttctttgagtggttggacgccaatgaaatcgat
cacttcatgacgatgtgtggcgaccgacactggcagtaccacagcattcatccgtcgggc
attcaagagtttgcttgcggcgccttgaatgacgaaaactctcgaatgggcgtgccgcct
gggtcacggcgaggcaccgaccctgaagctttgatcgaacagccattcatctcgccggaa
cccagcggaggcttcctatcggtcactgcgggcgaggatctgttagtcgagttttacaac
gacgagggcaaacttctctacgaagcccgcccctaa

DBGET integrated database retrieval system