KEGG   Rhodopirellula baltica: RB5856Help
Entry
RB5856            CDS       T00134                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RB5856 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB5856 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    RB5856 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RB5856 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RB5856 (adh)
   00626 Naphthalene degradation
    RB5856 (adh)
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RB5856 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3070709..3071869)
Genome map
AA seq 386 aa AA seqDB search
MSISAGTSVIPNDRKPESFADIVNVAMEFDSSERRFIACQSKLDPLSEGQVLVRVLCCTL
CGSDLHTVAGRREGHDRGVLGHEIVGEVLGWRGEFTPADYHGVPLRVGQRITWAMSVGCE
HCFYCNNDLNQKCDSLFKYGHEASHGHPTGGLSEHCVLVAGTPIFPVPDELTNEVVAPVN
CATATVSAALRLVNQTHQIKNATVLVVGAGMLGLTAAAQLNEAGASRIVVADPNADRAEL
AESFGATDLIVDETLDQRQAMLQEITNGRGVDIAIDFAGMTTAVNACLESVRMGGCVVLV
GSVFPSDPVALFPEQAVRRMLTIRGLHNYLPRDLDDGLRFLKRNHQRFPFEKLVGKGFPL
REVEQAFEFAMQQRPVRVAVYPSSDS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttcggctgggacgtcagtgattccaaacgatcgaaaaccagaatcgttcgct
gacatcgtgaacgtcgcgatggagtttgattccagtgaacgacgtttcattgcatgccaa
agcaaacttgatccgctaagcgaaggccaagtgctcgttcgagttctgtgctgcacgttg
tgcggaagtgatctgcacacagtcgcaggacgaagggaaggacacgaccgtggagtgctt
gggcacgagatcgtcggggaagtcttgggttggcgtggggaattcacgccggccgactac
cacggtgtaccgctgcgagtcggtcagcgtatcacgtgggcgatgtcggtcggttgcgag
cattgtttctattgcaacaacgatttgaatcagaagtgtgattcactgttcaaatacggc
cacgaagccagccatgggcatccgaccggcggactgagtgaacactgcgtgctcgtcgcg
gggacaccgatctttcctgtgccagatgagttgaccaacgaagtggttgcaccggtcaac
tgtgcgacggcgactgtttcggctgcacttcgattggtgaatcaaactcaccagatcaag
aatgcaacggttctcgtcgtcggggctggcatgcttggtttaacagccgcggctcaattg
aacgaagcgggggcatcacgaatcgtggtcgctgacccaaacgcggatcgagccgagctg
gctgaatcgtttggtgcaactgacttgatcgttgatgaaaccctggatcaacgacaggcg
atgcttcaagaaataaccaacggtcgcggcgtggacatcgcaatcgattttgcgggaatg
acgactgctgtgaacgcctgtttggaatcggttcgcatgggtggatgcgtggtgttagtg
ggatccgtgtttccgtcggacccagtcgcgctttttccggagcaagccgttcgccggatg
ctgacgattcgcgggctgcacaactacttgccacgcgatctggatgatgggttgcgattt
ttgaaacgcaaccaccagcgatttcctttcgaaaagctggttggcaaaggattcccgctc
cgcgaagttgaacaagcgtttgagtttgcgatgcagcaacggccagtgcgtgtggccgtg
tatccgtcctctgactcatga

DBGET integrated database retrieval system