KEGG   Rhodopirellula baltica: RB5897Help
Entry
RB5897            CDS       T00134                                 

Gene name
trx
Definition
protein disulfide-isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
rba  Rhodopirellula baltica
Brite
Enzymes [BR:rba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     RB5897 (trx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3090681..3091814)
Genome map
AA seq 377 aa AA seqDB search
MRLSSKPPRIDSSTASSQWSRVMPATVLLGLTTIFTSVAQADIQWRKDLTAAQAEAQQSG
KGLLLHFTSDNCVWCDRLEAGAFKSPEVGSAVEQKFVPVKVHAGKSPELAKMFGVTKFPT
DVMITPTGKPLGTSVSPQDPKRYVAMLAIAAKKMPTMMTTPAPGAPQTMMASNGQSPAGA
PATTAAATTPPRTQQNPHVAASNLPSPDSQFAGGATGRLAGARTDGMTLGMPAQSSPKPE
AKTPAFGTDQPKLAMEGFCSVTVINEDQWVEGNPKFGVVHLGKLYLFQNEAKMKTFLADP
TPYTPVLNEIDVVRFFEERVIVPGKRQFGMKDPVHQRMFFFADEAAMDHFWNEYERYTDA
AIEVMDHAVRDANPGVN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgtcctccaaaccaccgcgaattgattcttccactgcgtcctcgcaatggtcg
cgagtgatgccggcaacggtcttgctcggtttgacaacaatcttcaccagtgtcgcccaa
gctgatattcagtggcgtaaagatctcaccgccgcgcaagcggaagcacagcaaagcgga
aaaggtctgttgctgcacttcaccagtgacaattgcgtctggtgtgatcgcttggaagcg
ggtgctttcaagagtcccgaagtgggatccgctgtcgagcaaaagttcgttccggtcaaa
gtccacgctggcaaatcgcccgagttggccaagatgttcggtgtcacaaagtttccaacc
gatgtgatgatcacgccgaccggaaagcccttgggcacgtcggtcagcccgcaagatcca
aagcgatatgttgcgatgttggcaatcgcggcgaagaaaatgccgacgatgatgactacg
cctgcacctggtgcaccgcaaacgatgatggcatccaatggacaatcgccggctggtgct
cctgcgaccaccgctgccgcgaccacgccacctcgcacccagcaaaacccgcacgttgcc
gccagcaacttgccttcgcctgacagtcaattcgcgggaggagcaaccggtcgtttggcc
ggagctcgcaccgatggaatgactttaggcatgccagctcaatcgtcgccgaaaccagag
gccaagacaccggcctttggcaccgatcaaccaaaacttgcgatggaaggtttctgttcc
gtcaccgttatcaacgaagaccaatgggtcgaaggcaatccaaagtttggagtggttcac
ctcggaaagctgtatctattccaaaacgaagccaagatgaagacattcttggctgacccg
actccatacactcctgtgttgaacgaaatcgatgtggttcgtttctttgaagaacgtgtg
atcgttcctgggaaacgtcagtttggaatgaaagatccggttcatcaacgcatgttcttc
ttcgctgacgaagccgcgatggatcacttttggaatgagtacgaacgctacactgacgcc
gcgatcgaagtcatggaccacgccgtgcgggatgcaaatcctggggtgaactga

DBGET integrated database retrieval system