KEGG   Rhodopirellula baltica: RB6492Help
Entry
RB6492            CDS       T00134                                 

Gene name
recR
Definition
recombinant protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rba  Rhodopirellula baltica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rba03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3438696..3439295)
Genome map
AA seq 199 aa AA seqDB search
MSGHAGAVSDLVDQLSKLPGIGRKSAERLAFHLLRVHEDEALALASAIRRVRTDVRYCSV
CYNLSETELCRICSDPKRDATRLCVVEQPRDLLSLDASGVYSGLYHVLLGRIAPLDGITP
DQLTIDSLVERVRTGNFSEIIMATNPTVEGDGTSLYLSNLMQEFPVEITRLARGITSGSV
LEYANREIIADALTGRQRL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacatgccggtgcggtctctgatctagtcgatcaactcagcaagcttcccggg
atcggtcgcaaaagcgctgagcggttggcgtttcacttgttgcgagtccatgaggatgag
gcattggcgttggcatcggccattcgccgggttcgcaccgacgttcgatattgttcggtt
tgctacaacttgtccgagacggagttgtgcaggatttgctccgatcccaaacgcgacgcg
acccggttgtgtgtcgtcgaacagccccgcgatctgctcagcctcgatgcgtccggggtc
tattccggtctgtaccacgtcttgctcggtcgaattgcacccctcgacgggattacaccc
gaccaactgaccatcgattcactggtggaacgggtgcgaaccggaaatttttctgagatc
atcatggcgaccaatccaacggtcgaaggcgatgggacttctctgtatttatcgaactta
atgcaggaatttccggtggaaatcacacgattggctcgtggcatcacgtcgggcagtgtc
ctggaatatgccaatcgtgaaataattgccgatgcgttgacgggtaggcagcggttataa

DBGET integrated database retrieval system