KEGG   Rhodopirellula baltica: RB7095Help
Entry
RB7095            CDS       T00134                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
rba00010  Glycolysis / Gluconeogenesis
rba00051  Fructose and mannose metabolism
rba00562  Inositol phosphate metabolism
rba01100  Metabolic pathways
rba01110  Biosynthesis of secondary metabolites
rba01120  Microbial metabolism in diverse environments
rba01130  Biosynthesis of antibiotics
rba01200  Carbon metabolism
rba01230  Biosynthesis of amino acids
Module
rba_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB7095 (tpiA)
   00051 Fructose and mannose metabolism
    RB7095 (tpiA)
   00562 Inositol phosphate metabolism
    RB7095 (tpiA)
Enzymes [BR:rba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RB7095 (tpiA)
Exosome [BR:rba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RB7095 (tpiA)
  Exosomal proteins of bladder cancer cells
   RB7095 (tpiA)
  Exosomal proteins of melanoma cells
   RB7095 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1792807
NCBI-ProteinID: NP_867626
UniProt: Q7UP89
Position
complement(3766805..3767569)
Genome map
AA seq 254 aa AA seqDB search
MSRRILIAGNWKMNMRAESGASLAKGIVDAVGKSPAVEVVLCPPSVYLSGVADAVVGTPV
ELGAQNLYAAEDGAFTGEVNASMLTDVGCRFVILGHSERRQLMGETDACVAKKLHAALAG
NLVPIVCVGETLEQREADDTESVIETQIRGSLEGLDEARAANIVIAYEPVWAIGTGKTAS
KEQAEAVHAFIRELLGKMFSTEVAEQIRIQYGGSVKPGNAEELLSQPNIDGALVGGSSLK
VDDFAGIIKAAPSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgtcgcattctgattgctggtaactggaaaatgaacatgcgtgccgagtccggc
gcgtcgcttgccaaaggcattgtcgacgcggttggcaagtcgcccgctgtcgaagtcgtt
ttgtgccccccgtcggtttacctgagtggcgtggcggacgcggtcgttgggactcccgtg
gaattgggggcacagaacctgtacgccgccgaagacggtgccttcaccggtgaagtcaac
gcgtcgatgttgaccgacgtcggttgtcgatttgtgattctggggcacagcgagcgtcgc
caattgatgggcgaaacggacgcttgtgtcgcgaaaaagctgcacgccgcgttggctggc
aacttggttccgatcgtttgcgtgggcgaaaccctcgaacaacgcgaagcggacgacacc
gaatcggtcatcgaaacgcaaattcgcgggtcgctggaaggtttggacgaagctcgcgcc
gcgaatattgtcatcgcctacgagcccgtttgggcgatcgggactggcaaaactgctagc
aaagagcaagctgaagcggttcacgccttcattcgtgagcttttgggaaaaatgttctcg
accgaagtcgccgaacaaatccgaattcagtacggtggcagtgtgaaaccgggcaacgca
gaagaattgttgtcccaacctaatatcgacggggctctcgtcggcgggtcaagcttgaaa
gtggatgatttcgctggaatcatcaaagcggctccctccgcctga

DBGET integrated database retrieval system