KEGG   Rhodopirellula baltica: RB7095Help
Entry
RB7095            CDS       T00134                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RB7095 (tpiA)
   01230 Biosynthesis of amino acids
    RB7095 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB7095 (tpiA)
   00051 Fructose and mannose metabolism
    RB7095 (tpiA)
   00562 Inositol phosphate metabolism
    RB7095 (tpiA)
Enzymes [BR:rba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RB7095 (tpiA)
Exosome [BR:rba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RB7095 (tpiA)
  Exosomal proteins of bladder cancer cells
   RB7095 (tpiA)
  Exosomal proteins of melanoma cells
   RB7095 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3766805..3767569)
Genome map
AA seq 254 aa AA seqDB search
MSRRILIAGNWKMNMRAESGASLAKGIVDAVGKSPAVEVVLCPPSVYLSGVADAVVGTPV
ELGAQNLYAAEDGAFTGEVNASMLTDVGCRFVILGHSERRQLMGETDACVAKKLHAALAG
NLVPIVCVGETLEQREADDTESVIETQIRGSLEGLDEARAANIVIAYEPVWAIGTGKTAS
KEQAEAVHAFIRELLGKMFSTEVAEQIRIQYGGSVKPGNAEELLSQPNIDGALVGGSSLK
VDDFAGIIKAAPSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgtcgcattctgattgctggtaactggaaaatgaacatgcgtgccgagtccggc
gcgtcgcttgccaaaggcattgtcgacgcggttggcaagtcgcccgctgtcgaagtcgtt
ttgtgccccccgtcggtttacctgagtggcgtggcggacgcggtcgttgggactcccgtg
gaattgggggcacagaacctgtacgccgccgaagacggtgccttcaccggtgaagtcaac
gcgtcgatgttgaccgacgtcggttgtcgatttgtgattctggggcacagcgagcgtcgc
caattgatgggcgaaacggacgcttgtgtcgcgaaaaagctgcacgccgcgttggctggc
aacttggttccgatcgtttgcgtgggcgaaaccctcgaacaacgcgaagcggacgacacc
gaatcggtcatcgaaacgcaaattcgcgggtcgctggaaggtttggacgaagctcgcgcc
gcgaatattgtcatcgcctacgagcccgtttgggcgatcgggactggcaaaactgctagc
aaagagcaagctgaagcggttcacgccttcattcgtgagcttttgggaaaaatgttctcg
accgaagtcgccgaacaaatccgaattcagtacggtggcagtgtgaaaccgggcaacgca
gaagaattgttgtcccaacctaatatcgacggggctctcgtcggcgggtcaagcttgaaa
gtggatgatttcgctggaatcatcaaagcggctccctccgcctga

DBGET integrated database retrieval system