KEGG   Rhodopirellula baltica: RB7429Help
Entry
RB7429            CDS       T00134                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rba  Rhodopirellula baltica
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RB7429 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RB7429 (pyrB)
Enzymes [BR:rba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     RB7429 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3982983..3984014
Genome map
AA seq 343 aa AA seqDB search
MDASLSPDQLSFPAVWRHPHLLDLERLTAAEILAVLRTADQLKTMTEGCRRKVPLLTGKT
CANLFFENSTRTRNSFSLAAKRLGADTVEFSSSGSSVAKGETFVDTAKTIEAMGVDWVVT
RHSTPGTPHLLARELDCCVLNAGDGPHEHPTQGLLDMLTILQHRIGSDWKNEAADPEKVF
AGMTVALVGDIAHSRTARSNLWGLRKLGAHVIICGPPTLVSHRWEELGFEVAHRLDEIVH
RCDVLNLLRIQFERQKARPFPSVYEYAALYAMNGERLRLAKDDILIMAPGPINRGVEITP
EVADGPHSVILEQVTNGIAVRMASLWLLANAKENADASAENLS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggacgcatcgctctcacccgatcaattgtcattcccggccgtctggcggcatcctcat
ctgttggatttggagcggctcaccgccgctgaaatcctcgccgtgttacgcacggcggac
caactgaagacgatgaccgaaggttgccgtcgcaaagtcccgctattgacgggaaaaacg
tgtgccaatttgttctttgagaacagcacacgtacgaggaacagtttctcgttggccgcc
aaaagactcggcgccgacacggttgaattcagcagcagcggcagcagcgttgccaaaggc
gaaacattcgtcgacacggccaagaccatcgaagcgatgggcgtcgactgggttgtgacg
cgacactccactcccggcacgcctcacttgttggcccgcgaactggattgctgtgtgctc
aacgccggagacggtccccacgagcatcccactcagggtttgctcgacatgctgacgatc
ctccaacatcgcatcggctcggactggaaaaacgaagccgccgatcctgagaaagtattc
gcgggaatgacggtggctttggttggtgacatcgcacacagtcgcactgcacgcagcaat
ctgtggggcctccgtaaactcggtgctcacgtcatcatttgcggcccaccaactttggtc
agtcaccgctgggaagaacttggtttcgaagtcgctcaccgtctcgatgagatcgtccat
cgctgcgacgtgctgaatttgcttcgcattcaattcgaacggcaaaaggcgagaccattc
cctagcgtttacgaatatgcggcgttgtacgccatgaacggcgagagattgcggctggcc
aaagacgacatcctgatcatggcccccgggccaatcaatcgcggcgttgaaatcaccccc
gaagtcgccgacgggccgcattcggtgatcctcgaacaagtgaccaacgggatcgcagtc
cgcatggcatcgctgtggttgttggccaacgcgaaagaaaacgcagatgcatccgcggag
aacctctcatga

DBGET integrated database retrieval system