KEGG   Rhodopirellula baltica: RB7572Help
Entry
RB7572            CDS       T00134                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rba  Rhodopirellula baltica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RB7572 (pfkA)
   01230 Biosynthesis of amino acids
    RB7572 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB7572 (pfkA)
   00030 Pentose phosphate pathway
    RB7572 (pfkA)
   00051 Fructose and mannose metabolism
    RB7572 (pfkA)
   00052 Galactose metabolism
    RB7572 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    RB7572 (pfkA)
Enzymes [BR:rba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RB7572 (pfkA)
Protein phosphatases and associated proteins [BR:rba01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RB7572 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4066752..4068164)
Genome map
AA seq 470 aa AA seqDB search
MPQITSRIGRRLGETRWMLRIWALNRNAIVFGNSSSPGSVIVAELAHHNLDIKRVAILFA
GGPAPAANAVISTAAFSFLEEGAQVFGIKHGYSRLAEYTAAGPLQEGTDYIRFTHDSLTH
ARSSRGIMIGTARTNPGKHVSSPEHLKDPELVAPLRRVYEGLCSLEVDALISIGGDDTLK
TANKLKMFQDNLPGDARRFPVVHLPKTIDNDYSGIDFTFGFFTAVETLAEEIRNLNYDAA
AGRAYFLCEAMGRSAGWLAYGAAIAGEASMVLSVEDITGALADEEVVNQETGETRKIMAM
DRVIDRMVDMMLAREREGRQYGTIVIAEGMAEYLPAKYLEGVTRDDHGHINISLVNLSAV
MSRLLAARYNERTGRTRKVNGLQMGYESRCAPPHAYDVMLGSQLGVGAYRALVEEKLNGV
MVSVSGQFDLHFVPFEELVDPQTLVTKVRFIEQNSDFHRLARFLETCVDN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttgcctcaaatcacctcgcggattggcaggcgtcttggcgaaacgaggtggatgcttaga
atctgggctctcaatcgcaacgcgattgtcttcggaaattcctcttcaccaggcagtgtc
atcgtggctgagctcgctcatcacaatttggatatcaaacgcgtcgcgattttgttcgcc
ggcggacccgctccagccgccaatgcggtcatcagtaccgccgcgttttcgttcctggaa
gagggtgctcaggtctttggcatcaaacacggttacagccgtttggcggaatacaccgcc
gccggtccgttgcaagaaggcaccgactacatccggttcacgcacgattcgctgacccac
gctcgcagtagccgtggaatcatgatcggaacggctcgcaccaaccccggcaaacacgtt
agcagccccgaacacttgaaagaccccgagttggttgcgccgctccgtcgcgtctacgaa
ggattgtgttcactggaagtcgacgcgttgatctcgattggcggcgatgacacgttgaag
accgcgaacaaactcaagatgttccaggacaacctgcccggcgacgctcgtcgtttcccg
gtggttcatttgccgaaaacaatcgacaacgattactcaggcattgatttcacgttcgga
ttcttcaccgcggttgaaacattggccgaagaaattcgcaacctcaactacgatgccgcc
gctggacgagcttacttcctgtgcgaagccatgggacgcagtgccggttggttggcctac
ggtgcggccattgccggtgaagccagcatggtgctcagcgtggaagacatcaccggtgca
ctggcagacgaagaagtcgtcaatcaagagaccggtgagacccgcaaaatcatggcgatg
gatcgggtgatcgatcggatggtcgacatgatgttggcacgcgaacgcgaaggacgccaa
tacggcaccatcgtgattgcagaagggatggccgagtatctgccagcgaagtatctcgaa
ggcgtcacacgcgatgatcacgggcacatcaacatttcgttggtgaacctttccgccgtc
atgtcgcgtttgctggctgctcgttacaacgaacgaaccggccggactcgtaaggtgaat
ggattgcagatgggctatgagtctcgttgtgcaccaccgcacgcttacgacgtcatgttg
ggatctcaactcggcgtcggtgcttaccgagcgttggtcgaagagaaactgaacggcgtc
atggtttcagtctcgggacagtttgatctgcacttcgtgccattcgaagaattggttgac
ccgcaaacgttggtcaccaaagttcgctttatcgagcagaattcggacttccaccgtttg
gctcggttcttggaaacctgcgtcgataactga

DBGET integrated database retrieval system