KEGG   Rhodopirellula baltica: RB8541Help
Entry
RB8541            CDS       T00134                                 

Gene name
celM
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rba  Rhodopirellula baltica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rba00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4554758..4555831
Genome map
AA seq 357 aa AA seqDB search
MTTEMQPLEFFKQSILTPSPSGYEEPIQKLIGEYLKPHSDEVSIDVHGNLTARVGEAGGP
KLMLAGHCDQIGMLISHIDDQGFLYAQTIGGWDPQQLIGQSMTVWTDDGPVSAVISRKPI
HLLSQQERGEVVKLEQMWLDIGAKDGDEAKSKVRIGDCVTLNLAYRELLGDMVSGPGMDN
KTGMWTVIETARRCASSDQALQCELHSVATVQEEIGLRGAKTAAGRINPDVAIAVDVTHA
SDCPTIDKQQQGDIKIGGGPVIFRGPNINAKVAKRLMQLADDNDIAYQPAALGRAAPNDS
NVLQVSGSGVATGLVAIPNRYMHSAVETISLGDIEAIAKLLTLFAQSLTPECDFIPG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgaaatgcaaccgctcgaatttttcaagcaatccattctgacgcccagccct
tcgggttacgaagaaccgatccaaaaactgatcggcgaatacctgaaaccgcacagcgac
gaagtctcgatcgacgtgcacggaaacctgaccgctcgggtcggcgaagcgggtggcccc
aagctgatgttggctggtcactgtgaccaaatcggcatgctgatttcacacatcgacgat
caaggattcttgtacgcccaaacgatcgggggttgggacccacagcaactgatcggtcaa
tccatgacggtgtggaccgacgacggtcccgtctccgcggtcatcagtcgcaagccaatt
cacttgttgtctcaacaggaacgcggcgaggtcgtcaagctggaacaaatgtggctggac
atcggagccaaagatggtgacgaagccaaatcaaaagtccgcatcggcgactgcgtgacg
ttgaaccttgcctaccgagaactgctgggcgacatggtcagcggtccgggcatggataac
aaaacgggcatgtggacggtcattgaaaccgcccgtcgctgtgcctcgtccgatcaagcg
ttgcagtgcgaactgcacagcgtcgcgactgtccaagaggagatcggtctgcgtggagcc
aagaccgctgccggtcgcatcaacccagatgtggccatcgcggtggatgtcacgcatgca
tcagactgcccgacgatcgacaaacaacaacaaggcgatatcaagatcggtggcggcccg
gtgatcttccgcggccccaacatcaacgccaaagtcgcaaagcgactgatgcaattggcg
gacgacaacgacatcgcgtatcaacctgcggcgctcggccgcgccgcgccgaatgattcc
aacgtgttgcaggtttctggttcaggcgttgccacaggacttgtcgcgattcccaaccgc
tacatgcactcagccgtcgaaacgatcagcctcggtgacatcgaagcgattgcgaaactg
ctgacgctgttcgctcaatcgctgacaccagaatgcgatttcatccccggttga

DBGET integrated database retrieval system