KEGG   Rhodopirellula baltica: RB8541Help
Entry
RB8541            CDS       T00134                                 

Gene name
celM
Definition
(RefSeq) endoglucanase
Organism
rba  Rhodopirellula baltica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M18 Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 1791642
NCBI-ProteinID: NP_868423
UniProt: Q7UFI1
Position
4554758..4555831
Genome map
AA seq 357 aa AA seqDB search
MTTEMQPLEFFKQSILTPSPSGYEEPIQKLIGEYLKPHSDEVSIDVHGNLTARVGEAGGP
KLMLAGHCDQIGMLISHIDDQGFLYAQTIGGWDPQQLIGQSMTVWTDDGPVSAVISRKPI
HLLSQQERGEVVKLEQMWLDIGAKDGDEAKSKVRIGDCVTLNLAYRELLGDMVSGPGMDN
KTGMWTVIETARRCASSDQALQCELHSVATVQEEIGLRGAKTAAGRINPDVAIAVDVTHA
SDCPTIDKQQQGDIKIGGGPVIFRGPNINAKVAKRLMQLADDNDIAYQPAALGRAAPNDS
NVLQVSGSGVATGLVAIPNRYMHSAVETISLGDIEAIAKLLTLFAQSLTPECDFIPG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgaaatgcaaccgctcgaatttttcaagcaatccattctgacgcccagccct
tcgggttacgaagaaccgatccaaaaactgatcggcgaatacctgaaaccgcacagcgac
gaagtctcgatcgacgtgcacggaaacctgaccgctcgggtcggcgaagcgggtggcccc
aagctgatgttggctggtcactgtgaccaaatcggcatgctgatttcacacatcgacgat
caaggattcttgtacgcccaaacgatcgggggttgggacccacagcaactgatcggtcaa
tccatgacggtgtggaccgacgacggtcccgtctccgcggtcatcagtcgcaagccaatt
cacttgttgtctcaacaggaacgcggcgaggtcgtcaagctggaacaaatgtggctggac
atcggagccaaagatggtgacgaagccaaatcaaaagtccgcatcggcgactgcgtgacg
ttgaaccttgcctaccgagaactgctgggcgacatggtcagcggtccgggcatggataac
aaaacgggcatgtggacggtcattgaaaccgcccgtcgctgtgcctcgtccgatcaagcg
ttgcagtgcgaactgcacagcgtcgcgactgtccaagaggagatcggtctgcgtggagcc
aagaccgctgccggtcgcatcaacccagatgtggccatcgcggtggatgtcacgcatgca
tcagactgcccgacgatcgacaaacaacaacaaggcgatatcaagatcggtggcggcccg
gtgatcttccgcggccccaacatcaacgccaaagtcgcaaagcgactgatgcaattggcg
gacgacaacgacatcgcgtatcaacctgcggcgctcggccgcgccgcgccgaatgattcc
aacgtgttgcaggtttctggttcaggcgttgccacaggacttgtcgcgattcccaaccgc
tacatgcactcagccgtcgaaacgatcagcctcggtgacatcgaagcgattgcgaaactg
ctgacgctgttcgctcaatcgctgacaccagaatgcgatttcatccccggttga

DBGET integrated database retrieval system