KEGG   Rhodopirellula baltica: RB8613Help
Entry
RB8613            CDS       T00134                                 

Gene name
pfaS
Definition
phosphoribosylformylglycinamidine synthase I (purQ) (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
rba  Rhodopirellula baltica
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rba00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4595082..4595960)
Genome map
AA seq 292 aa AA seqDB search
MRIGFCSPSCLKSCFSMPQPRVLVLRAPGTNCDVETAHAFELAGAVAERVHVGRLMENAA
LASRYQILCLPGGFSYGDDIAAGRILATRMRRHLGDLMHHFVDSGDNLVLGICNGMQVLM
RLGVLTSGVGQLQTAGGPAESADDSVPPATLTWNNHGRFEDRWVNLAVDKTPCVFLRDIE
QMYLPMAHAEGKFIARDAEVLEELRSAGRLALRYCEPSGEIQSETLPFPINPNGGDANVA
GVCDASGRVFGLMPHPERHIDATQHPFWTRRKEQPEHGEGLQMFRNAVEWFA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgcggattggattttgttcaccttcctgcctgaaaagctgcttttccatgcctcagcct
cgcgttctcgtcctgcgtgctcccggtaccaactgcgatgtcgaaaccgctcatgccttt
gagttggccggtgcggtcgccgaacgcgtccacgtcgggcgactgatggaaaacgcggct
ttggcgagccgctaccaaatcctctgtcttcccggcggattcagctacggcgatgacatc
gcggccggccgaatcctggcgactcggatgcggcggcacttgggtgacttgatgcatcac
ttcgtcgacagcggcgacaacttggtgctggggatttgcaacgggatgcaggtcctgatg
cgcttgggcgttttgaccagcggcgtcgggcagttgcagaccgcgggcggacccgccgaa
tcggcggacgactccgttccacccgccacattgacctggaacaaccacggtcgattcgaa
gatcgctgggtgaacttggccgtcgacaaaacgccgtgcgtgttcctgcgagacatcgag
caaatgtatttgccaatggctcacgctgaaggcaagttcatcgcccgcgacgcggaagtg
ttggaagagttgcgatcggctggacgattggctctacgatactgcgagccatccggtgaa
attcaatccgaaacgttgccgttcccaatcaatcccaacggtggtgacgccaacgtggcc
ggggtgtgtgatgccagcggccgcgtatttggtttgatgccgcaccccgaacgacacatt
gatgcgactcaacatccgttttggactcgtcgcaaagagcagcccgaacacggtgaaggg
ttgcagatgttccgaaacgcggtggagtggtttgcttga

DBGET integrated database retrieval system