KEGG   Rhodopirellula baltica: RB8823Help
Entry
RB8823            CDS       T00134                                 

Gene name
xynE
Definition
endo-1,4-beta-xylanase 1 precursor (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
rba  Rhodopirellula baltica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4690285..4691280)
Genome map
AA seq 331 aa AA seqDB search
MLMRHVVCLVLSVSLLAGTVSFAGSPQTQSGDKSTSEANKKNASRKTKKKKPAPFAWVNP
IPKQREHPSLKHATFQSPSLNCDVGYAILMPPGYSDGDAGKRFPVVYYLHGGRPGSESKS
IALVPQMHLAMESGQVPGMIYVFVNGGPVSHYNIPKEPTKQGADVFIKELIPHIDATYRT
IADREHRGIEGFSQGGRGTMRLSLRYPDLFCSAAAGGGGYETERKISESGGRESETLVFA
EGDNVWDLAREYSKQKSQKVDWMIYVGTKGFNYQNNLEYMAFLKSLEIPFESIVVPEVPH
SAMKIYEQRCVDLMRFHAENFGLIDTSIEQE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgctcatgcgtcacgttgtctgtttggttctcagtgtatcgttgctcgcgggaaccgtc
tcgttcgcgggatcacctcagacgcagtccggggataagtcgacatcggaagctaacaag
aagaacgcatcgcgaaagacgaagaagaaaaagccggctccgttcgcgtgggtaaacccc
attccaaagcaacgggaacatccatcactcaaacacgcaacgtttcaaagcccatcgctg
aattgcgacgtcgggtacgcgattttgatgccgccgggatactctgatggtgatgcgggc
aagcgatttcccgttgtctattacttgcatggcgggcgaccgggtagcgaatcgaagtcg
atcgccttggttccgcagatgcatttggcaatggaatcaggccaagttccgggcatgatc
tacgtctttgtcaacggcggcccggtcagtcactacaacattcccaaggaaccaaccaag
cagggtgcggacgtgttcatcaaagaactgatcccacacatcgatgcaacttatcgaacg
attgctgatcgtgagcatcgtggaatcgaagggttctcgcagggcggacgtgggacgatg
cggttgtcgcttcgctacccggatctattttgcagtgcagccgcaggcggtggcggatac
gaaaccgaacgcaaaatcagtgagtcaggcggccgcgaatcagaaaccttggtattcgca
gaaggcgacaatgtgtgggatttggctcgggagtattccaaacagaaatcgcaaaaggtg
gattggatgatctatgtcgggaccaaaggtttcaattaccagaataatctggagtacatg
gccttcttgaaatcacttgagattccattcgaaagcattgttgttccggaggtcccccat
tctgcgatgaagatctatgagcagcgatgtgtcgacctaatgcgattccacgccgaaaat
tttggcttgatcgatacctcgatcgagcaggagtga

DBGET integrated database retrieval system