KEGG   Rhodopirellula baltica: RB8889Help
Entry
RB8889            CDS       T00134                                 

Gene name
phoD
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rba  Rhodopirellula baltica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rba00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rba00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rba02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4729717..4731300
Genome map
AA seq 527 aa AA seqDB search
MSRPTHADQVTSTAWNRRRFLAFTGALPAYVLSTQHAWADGKISFSSNPFSLGVASGDPD
HRGMVLWTRLAPSPLLPDGGMPAQTVEVTWEVATDDSMRNVVASGTQLATPQLGHSIHVE
LNQLESDRWYWYRFRCGDAESTIGRTRTMPLPHQLPDQVRFAVTSCQNYEQGLFTAYEQM
AADNVDMVFHLGDYIYEYEAGRNGKVRTHHGSEIMSLGDYRVRHAQYRSDPLLQNMHAQC
PWWLTWDDHEFDNNCACDISEESGVDSLSFLSRRANAYQAYYEMMPLRLRQIPRGSDMRL
YRSAQFGRLAEFSILDTRQYRTDQPNGDRKSPLNEAALDPTQSMLGTKQRGWLSRNLIRS
TATWNVLAQQVMMGMVNRSGDPDNHQFSMDQWPGYSHERMELLNYIRDRQVSNPVVLTGD
IHSNWANELRVDDRQTEQGLVATEFVATSLSSGGNGPDKPKNLDAVLAENACVKWHNTER
GYIRCDVTPNSWKSDYMVVDDVLKPGGKTFTRNSFVVESGSPKLNQA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaccaactcacgctgaccaagtcacttccaccgcctggaatcgtcgacggttc
ctagcatttaccggcgcgctgcccgcctacgtgctgtcgactcaacacgcctgggccgac
ggcaagatttctttttcaagcaatccattcagcctaggcgtcgcttctggagatcccgat
caccgcgggatggtcctatggactcgcttggcaccttcaccgttgcttcccgatggtggt
atgcctgcccaaaccgttgaagtgacttgggaagtcgcaacggatgactcgatgcgaaac
gtcgtcgcatccggcactcaactggccacccctcaacttggtcactccatccatgtcgaa
ctgaaccaactcgagtccgaccgttggtattggtatcgattccgatgcggcgacgctgaa
agcactatcggtcgcacccgcaccatgccactgccgcatcaactgcccgaccaagttcgc
tttgccgtgacctcgtgccaaaactacgaacagggtctcttcaccgcctacgagcaaatg
gcggctgacaacgtcgacatggtctttcacttaggcgactacatctacgaatacgaagcc
ggtcgcaatgggaaggtccgaactcatcatggatctgaaatcatgtcactgggtgactat
cgcgtccgccacgctcagtatcgatccgatccgttgctgcaaaacatgcacgctcagtgt
ccatggtggctgacatgggatgatcatgagtttgacaacaactgcgcttgcgacatctca
gaagagtcaggcgtcgactcactttcattcctttcgcgacgagccaacgcctaccaagcc
tattacgaaatgatgccgcttcgattgcgtcagattccccgcggcagcgacatgcgtctg
tatcgctcggctcaatttggacgactggccgagttctcgatcttggatactcgccagtat
cgaaccgaccaacccaacggcgatcgcaaaagcccactgaacgaagctgccttggatcca
actcagtcgatgttgggaacgaagcagcgcggatggttgtctcgcaacctgatccgatca
accgccacttggaatgtgctggcacagcaagtcatgatgggaatggtcaaccgttccggc
gaccccgacaaccatcagttctcgatggatcaatggcccggctattcccacgaacggatg
gaactgttgaactacattcgagatcgacaagtcagcaatcccgttgtcttgaccggcgac
attcattccaactgggccaacgaacttcgcgttgacgaccgacaaaccgaacaaggtctc
gttgccactgagtttgttgccacttcgctatccagtggaggaaacggtccagacaaaccc
aagaatctcgacgcggtgctggcagaaaacgcttgcgtcaaatggcacaacaccgaacgc
ggctacatccgctgcgacgtcacaccgaatagctggaagtccgattacatggttgtggat
gacgtgctgaaaccaggcggcaaaacattcactcgcaattccttcgttgtcgaatcaggc
tcacccaaactgaaccaagcctga

DBGET integrated database retrieval system