KEGG   Rhodopirellula baltica: RB9094Help
Entry
RB9094            CDS       T00134                                 

Gene name
hasC
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rba  Rhodopirellula baltica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RB9094 (hasC)
   00052 Galactose metabolism
    RB9094 (hasC)
   00500 Starch and sucrose metabolism
    RB9094 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    RB9094 (hasC)
Enzymes [BR:rba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RB9094 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4857876..4858808
Genome map
AA seq 310 aa AA seqDB search
MPFSYLKDRSMRVRKAVITAAAPNQNTLPLQRLVDGSGEEKTALQLIVEETLSAGVEEIC
VVIQPGDEDNYRKAAGGSLGNLQFVHQERPLGYADAILQAESFCGDDAFLHLVGDHLYLS
ATSKTCAAQLIEMAEQHSCPVSAVQSTREHRLPYFGIVAGASVPRFDGLYDVRTVVEKPT
PTLAEQSLITPGLRSGYYLGYFGMHVLTPAVMECLHEVVADQSMERPSLSDAMAKLPHRG
KYLAYQLLGRRYNIGEQYGVLIAQLAIGLSGRDRDLLLTELVELLATRTENPVTATIDPP
SESSSLEGSN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttgcctttttcttatctcaaagatcgatccatgcgagttcgaaaagcggtcatcaccgcc
gcagcccccaatcaaaacaccctgccgctgcaacgcctggtcgacggttcgggcgaggaa
aaaacagctctgcagttgatcgtcgaagaaacgctctcggcgggcgtggaagagatctgc
gtcgtgatccagcccggcgatgaggacaactaccgcaaggcggccggtggctcgctcggc
aaccttcaattcgtccatcaagaacgaccgctcgggtacgccgacgccatcctgcaagcg
gaatcgttttgcggggacgatgctttcctgcatcttgtcggcgatcacctgtatctgtct
gccacgtcaaaaacatgcgcagcacaactgatcgagatggctgaacaacattcctgtccg
gtctccgcggtccagtccactcgagaacaccgcttgccatactttggcattgtcgccgga
gccagcgtgcctcgattcgatggattgtatgacgtgcgaaccgttgtcgaaaaaccaacg
cccacactcgcagaacaatctttgatcacgccaggtctgcggagcggctactaccttggc
tactttggcatgcatgtcctgactcccgcggtcatggaatgcctgcacgaagtcgtcgcc
gatcaaagcatggaacgcccctcgctgtccgatgcgatggcaaaacttcctcaccgaggc
aaataccttgcctatcagctcctgggacgtcgttacaacatcggcgaacagtacggcgtt
ctgatcgcacaattggccatcggattgtccgggcgcgatcgagatttgttgttgaccgaa
ctggtcgaacttcttgccacgcgaacggaaaatccagtcacggcaaccattgatccacca
tcggaatcgtcctcattggaaggatccaactga

DBGET integrated database retrieval system