KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522411Help
Entry
108522411         CDS       T04641                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108522411 (ABHD12)
Peptidases [BR:rbb01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108522411 (ABHD12)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108522411 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 398 aa AA seqDB search
MRKRTEPVALEHERCAASGSSSSGSAACGRWTPDCRLKALRLTGXGAAEPRCAADAGMKR
ALGRRKSLWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTYNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHAIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQ
FVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagccggtcgccttggagcatgagcgctgcgccgcctcgggctcg
tcctcctccggctcggccgcctgcggccgctggacgccggactgccgcctgaaagccctg
cgcctgacgggcnacggggcggccgagccgcgctgcgcagccgacgcgggaatgaaacgg
gcgctgggcaggcgaaagagcctatggttgcgcctgaggaaaatactcttctgtgttttg
gggttgtacattgccattccatttctcatcaaactatgtcctggaatacaggccaaactg
attttcttgaatttcgtaagggttccctatttcattgatttgaaaaaaccacaggatcaa
ggtttgaatcacacatataactactacctgcagccagaggaagacgtgaccattggagtc
tggcataccgtccccgcagtctggtggaagaacgcccaaggcaaagaccagatgtggtat
gaggatgccttggcttccagccacgctatcattctgtacctgcatgggaacgcaggtacc
agaggaggtgaccaccgcgtggagctttataaggtgctgagttcccttggttaccatgtg
gtcacctttgactacagaggttggggtgattcggtgggaacgccatctgagcggggcatg
acctatgacgcactccacgtttttgactggatcaaagcaagaagtggtgacaaccctgtg
tacatctggggccactctctgggcactggtgtggcgacaaatctggtgcggcgtctctgt
gagcgagagacgcctccagatgcccttatattggaatctccattcactaatatccgcgaa
gaagctaagagccatccattttcagtgatatatcgatatttccctgggtttgactggttc
ttccttgatcctattacaagcagtggaattaaatttgcaaatgacgaaaatgtgaagcac
atctcctgtcccctactcatcctgcacgctgaggacgacccggtggtgcccttccagctt
ggcagaaagctctatagcatcgctgcaccagctcgaagcttccgagacttcaaagttcag
tttgtgccctttcattcagaccttggctacaggcacaaatacatttacaagagccctgag
ctgccacggatactgagggaattcctggggaagtcggagcctgagcaccagcactga

DBGET integrated database retrieval system