KEGG   Rickettsia bellii RML369-C: RBE_0032Help
Entry
RBE_0032          CDS       T00339                                 

Gene name
folKP
Definition
folate synthesis bifunctional protein (EC:2.5.1.15 2.7.6.3)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rbe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32280..33596
Genome map
AA seq 438 aa AA seqDB search
MIYISIGSNLGNRFLNIRRALNLLKSHGFVLLRQSIIFETQAILPPNADSSWDRPYYNMV
VQGTTALLPNALLTVLKKIEQQIGRKENYDKWCPRVIDLDILLWDSYHIDLPDLKIPHSQ
LLNRPFLIHLIASLSIECRYICPDNNLYNDKAFAEIAHLIENQGVIRSLVLNPQFVGILN
ITPDSFSDGGLSFHKEDAVKNFVHLMDAGSSMIDLGAQSTRPSAFMISEDEEYTGLDSVL
EELKGVIEKTEALISIDSFSPEVIKRILKKYPVHCINLVKTNLDNDTLRLIADYNCKIVI
MHSLTVPPQKQQCLDFDKSLIISLNIWAEQEIAKLEKCGFDRKDIIFDPGIGFGKSVYQN
LHILQNIQEFKKLGCEILVGHSRKSYISTFYNSIAKERDLETIAISKYLAENGVNYLRVH
NVEDHQRFFVTQAYTLNK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatttctataggcagtaatttaggcaacaggtttttaaatattagaagagct
ctaaatttactcaaaagccatggttttgtactacttaggcaatctattatttttgagacg
caagctattctaccacctaacgcagatagtagttgggatagaccatattataacatggtg
gtacaaggtactactgctttattgcccaatgcactgctaactgtgcttaaaaagattgaa
cagcaaataggcagaaaagagaattatgataaatggtgtccacgagttattgatctagat
attttactttgggatagttatcatatagatttaccagatttaaaaatacctcattcccaa
ttattaaatagaccgtttcttattcatcttattgcaagcttgagcatagaatgccgttat
atttgccctgataataacctctataacgataaagcttttgcagaaatagcccatttaatt
gaaaatcaaggggttatacgctcacttgttttaaatcctcaatttgttggtattttaaat
attactcctgattctttttctgatggaggtttgagttttcataaggaagatgccgttaag
aattttgtacatttaatggatgcaggatctagtatgatcgatcttggtgctcagtcaaca
cgtccctctgcttttatgattagtgaggatgaagaatatactgggcttgatagtgttctt
gaagagctaaaaggagttatagaaaaaacagaagcccttattagtatcgatagtttttcg
cctgaagtgattaaacgaattctaaaaaaatatcccgttcattgtattaacttagttaaa
actaatttagataatgatacattacgattaattgcagattataattgtaaaattgttatt
atgcattcgctaaccgttccgccacaaaaacagcaatgtcttgattttgataaatctctg
attattagcttaaatatatgggcagagcaagaaatagcaaaattagaaaaatgtggattt
gatagaaaagatataatttttgatccgggtataggttttggaaagtctgtttatcaaaat
ttacatatattacaaaatattcaagaatttaaaaaattaggatgtgagatattagttggt
cactcaagaaaatcttatatttctactttctataattctatcgcaaaagaaagagattta
gaaacaatagcaatatcaaaatatttagctgaaaatggggtcaactatttacgagtgcat
aatgttgaagatcatcaaagattctttgtaacacaggcatatactcttaataaataa

DBGET integrated database retrieval system