KEGG   Rickettsia bellii RML369-C: RBE_0300Help
Entry
RBE_0300          CDS       T00339                                 

Gene name
pdhC
Definition
(GenBank) Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
rbe00010  Glycolysis / Gluconeogenesis
rbe00020  Citrate cycle (TCA cycle)
rbe00620  Pyruvate metabolism
rbe01100  Metabolic pathways
rbe01110  Biosynthesis of secondary metabolites
rbe01120  Microbial metabolism in diverse environments
rbe01130  Biosynthesis of antibiotics
rbe01200  Carbon metabolism
Module
rbe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBE_0300 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RBE_0300 (pdhC)
   00620 Pyruvate metabolism
    RBE_0300 (pdhC)
Enzymes [BR:rbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RBE_0300 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Swi5
Motif
Other DBs
NCBI-ProteinID: ABE04381
UniProt: Q1RJT3
Position
complement(340406..341662)
Genome map
AA seq 418 aa AA seqDB search
MPIKLLMPALSPTMTEGNLARWLKKEGDKINPGEVIAEIETDKATMEVEAVDEGTLAKII
IPQGSQNVPVNSLIAVLIEEGEELSGIEEFIAKNNSNSPKKEEISKPAETIAPQNVKEEN
ITTASDQNNIKVFASPLAKRLAKIQNVRIEEIKGSGPHGRIIKQDVLSHKGGSKALSNKI
VSRNPEEYRLAPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFGDDK
SAKISVNDFIILAVAKALQEVPNANASWGDDAIRYYNNVDISVAVAIENGLVTPIIRNAD
QKNIVDLSSEMKGLIKKARENKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGV
GSSSKRAIVKNDQISIATIMDVTLSADHRVVDGAVGAEFLAAFKRFIESPALMLLYTR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaaacttttaatgcctgctttatctccaactatgacggaagggaatttagca
aggtggttaaaaaaagaaggggataaaatcaatcccggagaagtaatcgctgaaatcgaa
accgataaagcaactatggaagtggaggcagtggatgaaggcactcttgctaaaataatt
attcctcaaggtagtcagaacgtgcctgtgaattcgttaatagcggtattaatcgaagag
ggggaagaattatccggaattgaagaatttatagcgaaaaataacagtaactcacctaaa
aaagaagaaatatcaaaacctgctgaaactatagctcctcagaacgttaaggaagagaat
attacgaccgcttcagatcaaaacaatattaaagtgtttgcttcaccgcttgctaaaaga
ctcgcaaaaatccaaaatgtcagaattgaagaaattaaaggcagtggaccgcatggcaga
ataatcaaacaagatgtgttatcacataaaggcggctcaaaagccttaagtaataagata
gttagtagaaatcctgaagaatatcgtttagcacctaataacaatatacgtaaaattata
gctaagcgtcttcttgaatcaaaacaaacagttccacatttttatttatcaatagaatgt
aatgttgataagttactagatataagagaagatattaataagtcttttggtgatgataaa
tccgcaaaaatatcagtaaatgactttattatcctagctgttgctaaagctttgcaagaa
gtaccgaacgctaatgcatcgtggggggatgatgctattagatactacaataatgttgat
atttcagtagcggtagcgatcgaaaatggacttgttactccgataattagaaatgctgac
cagaaaaatattgtagatctgtctagtgaaatgaaaggactaatcaagaaagctagagaa
aataaattaactcccgaagaattccaaggcggagggtttactatttcaaatcttggtatg
tatggtattaaaaatttcaatgctataattaacccgccgcaaagttgtataatgggcgtt
ggtagtagctcaaagcgtgctatagtcaaaaatgatcaaataagtatagcaacaattatg
gacgtaactctttctgctgaccacagagtagtagatggagcagttggagcagaattctta
gctgcatttaagaggtttatagaaagccctgctttaatgttgttgtatactcgatga

DBGET integrated database retrieval system