KEGG   Rickettsia bellii RML369-C: RBE_0409Help
Entry
RBE_0409          CDS       T00339                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rbe  Rickettsia bellii RML369-C
Brite
Enzymes [BR:rbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     RBE_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(455161..455334)
Genome map
AA seq 57 aa AA seqDB search
MRQKLNQGEYSNAADALLRWIKAKGGMKLQGLVRRRTLERSLFLSEIATAAVIISSA
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
ttgcggcaaaaacttaaccaaggcgaatactcaaacgccgccgatgcgttgcttagatgg
ataaaagctaaaggcggtatgaagctgcaaggcttggttagacgccgaacattagagcgg
tcattgtttttgagcgaaatagctacagcagcggttattattagctctgcctaa

DBGET integrated database retrieval system