KEGG   Rickettsia bellii RML369-C: RBE_0666Help
Entry
RBE_0666          CDS       T00339                                 

Gene name
def
Definition
polypeptide deformylase (EC:3.5.1.31)
Orthology
K01450  
formylmethionine deformylase [EC:3.5.1.31]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
Cysteine and methionine metabolism
Glyoxylate and dicarboxylate metabolism
Brite
KEGG Orthology (KO) [BR:rbe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RBE_0666 (def)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RBE_0666 (def)
Enzymes [BR:rbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.31  formylmethionine deformylase
     RBE_0666 (def)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
746681..747268
Genome map
AA seq 195 aa AA seqDB search
MYCYLRSIMPILKIIKTPNSLLRIKSLPVTIIDSQMKDFMKSMLETMYNEEGIGISAIQV
GKPIRALIVDIPKEENDQIKREPFFIINPEVNYLSEEKVILNEDCLSIRKEDGIAFIIGD
VERPKNISISYIDLEGNSKELTCNGNNSDYDLWFSRCLQHELDHLDGILFIDRLYNAKFP
KTEIEISGNLQTENI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtattgttacctaaggtctatcatgcccattttaaaaataataaaaacacctaactct
ttgcttagaataaaatcactgcctgttactataatcgatagtcaaatgaaagactttatg
aaatcaatgttagaaactatgtataatgaagaaggtataggaatatcagcaattcaagta
gggaaacctataagagctttaatagttgatatacctaaagaagaaaatgatcaaattaaa
agagaacctttttttataataaatcctgaagtaaattatttgtcagaagaaaaagttatt
ttaaatgaagattgcctttctataaggaaagaagatgggatagcttttattataggagat
gtggaaagacctaaaaatataagtattagctatattgatttagaaggtaattcaaaagaa
ttaacatgtaatggtaataattcagattatgatttgtggttttcaagatgtttacagcat
gagcttgatcatttagatggtatcttatttatagatagattatataatgcaaaatttcct
aaaactgaaattgagatatcaggcaatttacaaacagaaaatatttaa

DBGET integrated database retrieval system