KEGG   Rickettsia bellii RML369-C: RBE_0803Help
Entry
RBE_0803          CDS       T00339                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RBE_0803 (folE)
Enzymes [BR:rbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RBE_0803 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
890049..890627
Genome map
AA seq 192 aa AA seqDB search
MTIKKPTKEEAKEAVRTLLRFIGEDPNREGLFKTPDRVIKSYEEIFSGYGKNIEEILETK
FSDTGNFQDFISLEGIKFTSFCEHHMLPFSGTVHIAYIPDNCIVGISKLARIVNAFAKRL
QIQEKMTVQIAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSIMNTMHYTGIFAEQQK
YRHEFLNLTSKK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaaaaaaccgacgaaagaagaagcaaaagaggcagtaagaacattactaaga
tttatcggtgaggatcctaatcgtgagggattatttaaaactcccgatagagtaatcaaa
agttatgaagaaatattttcaggatatggcaaaaatattgaggaaatattagaaacaaaa
tttagtgataccggtaattttcaagattttatctcattagagggcataaaatttacctct
ttttgtgaacatcatatgttaccttttagcggtacagtacatatagcttatattccggat
aattgtattgtcggtataagtaagcttgcacgaatagtaaacgcttttgctaagagatta
caaattcaagaaaaaatgacagtacaaatagctgaaagcgtgcaagaaaatttaaagcca
cttggtgttgcagttaaaatatcagctttacatagctgtatgtcaatgcgtggtgtaatg
caagataacagcatcatgaacactatgcattatacgggaatattcgccgaacagcaaaaa
tatcgtcatgaattcttaaaccttacttcgaaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system