KEGG   Rickettsia bellii RML369-C: RBE_0852Help
Entry
RBE_0852          CDS       T00339                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rbe00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rbe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
938537..939961
Genome map
AA seq 474 aa AA seqDB search
MTPTLKQLFEKHNVKGLSNNSKTIKANDAFFAIKNGNDFIADALEKGAALVITDDKKNTT
NKVIFVEDIKETLHEAIELFYPKKPKTMIAVTGTNGKSSVVSYIAQIYSLIGQKAASIGT
IGVEVFGIDNFNESIGGLTTTDYLSFRKIAHKLAKNGIDYLAFEASSHGLDQQRLGDLKV
NVACFTSFSQDHLDYHHTKENYLLAKLKLFTDHLAKDGIAILNSDIEEIKFIKDYLDKHK
IKYLCVGANGNCKITKTNSSLKGQNINFIFDNKNYDFDTPIIGSFQASNLLIAGPSVYYT
SFDFSKVINALTKVKAVKGRMERVNRTNIFIDYAHTPDALEKALTELKNIKAKGGKLSII
FGCGGNRDTTKRKLMGKIAASIADNVIVTDDNPRHEDPKAIRQEIISGIVTTNYIEIADR
KEAIKYGINNLKKDDILLIAGKGHENYQIIGDEKIRFDDAEVASMSFLATAGIQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacccctaccttaaaacaattatttgaaaaacataacgtaaaaggtttatcgaataat
tctaaaactattaaggcaaacgatgccttttttgctattaaaaatgggaatgattttatt
gcagatgctttagagaaaggagcagcattagttattactgatgataaaaaaaacactaca
aataaagtaatctttgtggaagacatcaaagaaactttacatgaagctatagaactcttt
taccctaaaaaacctaaaactatgatagccgtaactgggactaacggcaaaagctcagta
gtatcatacatagctcaaatatattcgttaattggacaaaaagcagcatcaataggcaca
ataggcgtagaagtttttggcatcgataattttaatgagtccataggcggattaactaca
actgactatttaagttttagaaaaattgctcataaactagctaaaaatgggatagattat
ttagcatttgaagcttcaagccacggcttagatcaacaaaggcttggcgatttaaaagta
aatgttgcatgtttcactagctttagccaagatcaccttgactatcatcacacaaaagaa
aattatttgcttgctaaattaaagttatttaccgatcatttagcaaaagatggcattgca
atattaaattctgatatagaagaaataaagtttattaaagattatttggataagcataag
ataaaatatttatgcgttggagcaaacggtaattgtaaaataactaaaactaacagttct
ttaaaaggacaaaatattaattttatctttgataataaaaattatgattttgatacccca
ataataggtagctttcaggctagtaatttattaatagccggacctagtgtttattatacc
agttttgattttagtaaagttataaatgctttaactaaagttaaagccgtaaaaggacga
atggaacgagtgaacagaactaatatattcattgattatgcccatactcccgacgctctt
gaaaaagctttaactgagctaaaaaatattaaagctaagggtggtaaattaagcataatt
tttggctgtggcggtaatcgtgatactaccaaaagaaaacttatgggaaaaatagcagcc
tcaatagcagataatgttattgtgacggacgataacccacgccatgaagacccaaaagct
atcaggcaagaaattattagcgggatagtaacaacaaactatatagaaatagctgacaga
aaagaagctattaaatacgggataaataatttaaagaaagacgatattttactaatcgcc
ggcaaaggacatgaaaattatcaaattataggtgatgagaagataaggtttgatgacgcc
gaggtggcatctatgtcattcttagcaacggcgggaatccagtaa

DBGET integrated database retrieval system