KEGG   Rickettsia bellii RML369-C: RBE_0956Help
Entry
RBE_0956          CDS       T00339                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rbe  Rickettsia bellii RML369-C
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rbe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RBE_0956 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RBE_0956 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052317..1052838
Genome map
AA seq 173 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFIANILYKPVLEPKHRGYSIAVQEVSEAPTTQAQAP
INIPELMKTANADNGREIAKKCLMCHSLDKDGPNKIGPHLWDVAGRPKASITDYKYSPAL
SALGGNWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaactaaataaaattgttgcagctatattgtttgcaagtttaattgct
atgatggttgggtttattgcaaatatattatataaacccgttttagaaccaaaacatcga
ggttatagtattgcagtgcaggaagtttcagaagcacctactacacaagcacaagcccca
atcaatataccggaattgatgaaaacagcgaatgctgataatggtcgtgaaatagctaaa
aaatgtttaatgtgccattctcttgataaagatggtccaaataagataggacctcattta
tgggatgtagcaggtcgccctaaagcaagcataacggattataaatattcccctgcttta
tcagcccttggaggtaattgggatgatgatagtttatttgctttcttacataaaccaagt
agctatgctcctggtactaaaatgtcttttgccggtatatcaaaaccacaagatatcgca
gatgttatattatttttaaaaacttatgttcatgataaatga

DBGET integrated database retrieval system