KEGG   Rickettsia bellii RML369-C: RBE_1085Help
Entry
RBE_1085          CDS       T00339                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rbe  Rickettsia bellii RML369-C
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1171583..1172038
Genome map
AA seq 151 aa AA seqDB search
MLALQLAKVLIKQFESLQLTPYYCPAGLKTIGYGHVIKPHEMLHLANKITEEDAEKLLDA
DIAEVNCVLYKYCHSSLNINQQVALISFIFNCGSTAFKNSTLLKKLNQNKYLEAADEFLK
WIYVKGKKLKGLVKRRQIERAIFLGKNTTEN
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccctacaacttgctaaagtcttaattaaacaatttgaatctctacaactaact
ccttattattgcccagcaggacttaaaacaattggttatggtcatgtaataaaacctcat
gaaatgttacatttagctaataaaataactgaagaagatgctgaaaaattacttgatgca
gatatagcagaagtaaattgtgttttatataaatactgccacagttctttaaacattaat
caacaagtagcattaatttctttcatcttcaattgtggtagcacagcatttaaaaattct
acattgcttaaaaaactcaaccaaaataaatatctagaagctgctgatgaatttcttaaa
tggatttatgttaaaggtaaaaaattgaaagggcttgttaaacgtagacaaattgagaga
gctatattcttaggtaaaaatacaaccgaaaattaa

DBGET integrated database retrieval system