KEGG   Rickettsia bellii RML369-C: RBE_1167Help
Entry
RBE_1167          CDS       T00339                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rbe  Rickettsia bellii RML369-C
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RBE_1167 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBE_1167 (sdhD)
   00650 Butanoate metabolism
    RBE_1167 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RBE_1167 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1261322..1261699)
Genome map
AA seq 125 aa AA seqDB search
MTYDFRAEIVKAKNTGSAKSGSHHWLLQRITAIILVLCSLWLLYFTLANKNSDVNIIIWE
LKRPINLIPLLIAVITSLYHAMLGMQVVIEDYISCNKLRNTLIIAVKLFSILTIVAFIVA
VFYRG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacatatgattttagagcagagattgtaaaagcaaaaaatactggttctgctaaaagt
ggttcacatcattggttgctacaaagaattaccgctattatattagtgttgtgttcttta
tggttactatattttacgctagccaataaaaatagtgatgtaaatattattatttgggag
ctgaaaagacctattaatttaatacctttattaatcgcagtaattacttctttatatcat
gccatgcttggaatgcaggtagtaatagaggattatataagctgcaacaagttacgtaat
acattaattatagcagtgaagctatttagtattctaactatcgtagcttttatagtagct
gtgttttataggggataa

DBGET integrated database retrieval system