KEGG   Rickettsia bellii RML369-C: RBE_1228Help
Entry
RBE_1228          CDS       T00339                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
rbe00020  Citrate cycle (TCA cycle)
rbe00640  Propanoate metabolism
rbe01100  Metabolic pathways
rbe01110  Biosynthesis of secondary metabolites
rbe01120  Microbial metabolism in diverse environments
rbe01130  Biosynthesis of antibiotics
rbe01200  Carbon metabolism
Module
rbe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBE_1228 (sucC)
   00640 Propanoate metabolism
    RBE_1228 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RBE_1228 (sucC)
Enzymes [BR:rbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RBE_1228 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABE05309
UniProt: Q1RH55
Position
complement(1320494..1321651)
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGVVVTKTESINAAIDELNTKVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSVVFDRSASC
ITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQNFHAQGIAYELGFKDHQVKQMKEI
VKATYKAFIETDAAQIEINPLIVNKEGNLLALDAKFTFDDNGLFKHPEIMALRDQDEEDP
LETRAADAGLSYVKMDGSIGCMVNGAGLAMATMDIIKLYGATPANFLDVGGGADRERVKE
ALKIILSDKEVKGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGKEI
LSNSGLEIIPAHDLADAASKIVEAI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaatatcaagcaaaagagattttaagaaaatacggtgtgcctacttca
actggggtagtggttacaaaaaccgaaagtattaatgcagcgattgatgagctaaataca
aaggtttatgtagttaaggcacaaatacatgctggtggtagaggtaaagccggcggtgtt
aaggttgttaagagtaaagaggaagcaaaaaaagttgctcatgatatgttcggtattaat
ttagtcacacaccaaacaggaccacaaggacagaaagtaaatcgtctttatattgaatca
ggttgtgatattttaaaagaatattattttagtgtcgtatttgatagatcagctagctgc
atcacctttatagcttctacggagggcggtgttgatattgaagaagttgcagaaaaaact
cctgaaaaaattatcaaattttcagttgatccagctaccggcttgcaaaatttccatgct
caaggaatagcatatgaattaggttttaaagaccatcaagtaaagcaaatgaaagaaata
gtaaaagcaacttacaaagcttttattgaaacagatgcagcacaaattgagattaatccg
ctaattgtaaataaagagggcaatttattagcattagatgcaaaatttacctttgatgat
aatggtctatttaagcaccctgaaattatggctctacgtgatcaagatgaagaagatccg
ttagaaacaagagcagctgatgccggtcttagctatgtgaaaatggatggtagtattggt
tgtatggtaaatggtgcagggcttgctatggcaacaatggatattattaagctttatggt
gcaacacctgcgaatttcctagatgttgggggcggagctgatcgtgaacgtgtgaaagaa
gccttaaaaataattttatctgataaagaagtaaaaggcattttagttaatattttcggc
ggtatcatgcgttgtgatatcatagcagaaggaattatcgcagcagcaaaagatataggt
ataaaagtgccgctagtagtccgcttagctggtacaaatgttgagaaaggtaaagagatt
ttatccaattcaggtttagaaataataccggctcatgatttagctgatgcggctagtaaa
atagtagaagcaatttag

DBGET integrated database retrieval system