KEGG   Rickettsia bellii RML369-C: RBE_1228Help
Entry
RBE_1228          CDS       T00339                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:rbe01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rbe00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rbe00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1320494..1321651)
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGVVVTKTESINAAIDELNTKVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSVVFDRSASC
ITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQNFHAQGIAYELGFKDHQVKQMKEI
VKATYKAFIETDAAQIEINPLIVNKEGNLLALDAKFTFDDNGLFKHPEIMALRDQDEEDP
LETRAADAGLSYVKMDGSIGCMVNGAGLAMATMDIIKLYGATPANFLDVGGGADRERVKE
ALKIILSDKEVKGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGKEI
LSNSGLEIIPAHDLADAASKIVEAI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaatatcaagcaaaagagattttaagaaaatacggtgtgcctacttca
actggggtagtggttacaaaaaccgaaagtattaatgcagcgattgatgagctaaataca
aaggtttatgtagttaaggcacaaatacatgctggtggtagaggtaaagccggcggtgtt
aaggttgttaagagtaaagaggaagcaaaaaaagttgctcatgatatgttcggtattaat
ttagtcacacaccaaacaggaccacaaggacagaaagtaaatcgtctttatattgaatca
ggttgtgatattttaaaagaatattattttagtgtcgtatttgatagatcagctagctgc
atcacctttatagcttctacggagggcggtgttgatattgaagaagttgcagaaaaaact
cctgaaaaaattatcaaattttcagttgatccagctaccggcttgcaaaatttccatgct
caaggaatagcatatgaattaggttttaaagaccatcaagtaaagcaaatgaaagaaata
gtaaaagcaacttacaaagcttttattgaaacagatgcagcacaaattgagattaatccg
ctaattgtaaataaagagggcaatttattagcattagatgcaaaatttacctttgatgat
aatggtctatttaagcaccctgaaattatggctctacgtgatcaagatgaagaagatccg
ttagaaacaagagcagctgatgccggtcttagctatgtgaaaatggatggtagtattggt
tgtatggtaaatggtgcagggcttgctatggcaacaatggatattattaagctttatggt
gcaacacctgcgaatttcctagatgttgggggcggagctgatcgtgaacgtgtgaaagaa
gccttaaaaataattttatctgataaagaagtaaaaggcattttagttaatattttcggc
ggtatcatgcgttgtgatatcatagcagaaggaattatcgcagcagcaaaagatataggt
ataaaagtgccgctagtagtccgcttagctggtacaaatgttgagaaaggtaaagagatt
ttatccaattcaggtttagaaataataccggctcatgatttagctgatgcggctagtaaa
atagtagaagcaatttag

DBGET integrated database retrieval system