KEGG   Rickettsia bellii RML369-C: RBE_1420Help
Entry
RBE_1420          CDS       T00339                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rbe01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rbe00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1513443..1514618
Genome map
AA seq 391 aa AA seqDB search
MHTTYLKNLIGFESLTPQSNGAIEYIDDLLKEHGFKTEVKIFGETEQVTNLYAVYGNSKP
NICFVGHVDVVPAGDPNLWHNSNPFKAHEQEGKIYGRGTVDMKGSIACFLAASLDFIKNN
TDFVGSISFLLTSDEEGKAKHGTKEMLQYIYNQGHEIDFAIVGEPTCEKEIGDTIKIGRR
GSINFKLAVKGLGGHVAYPQKANNPLPCLIRILNELTNIKLDKGTEFFQNSNLEVTNIDV
DNNTTNVIPETATVHFNIRFNNLHSAETLAKQVEEIIKQHCQKHKLDYTLEYNSSADSFI
QNPNDKIKEFATIVEKTLNIKPKFSTSGGTSDARFVKNYCPLVEFGLLSDTAHKINEYTK
ISDLQKLYDVYYNFLMETLNVTGSPPLLGMT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcacactacctacctaaaaaacttgatcgggttcgaatccctaactccccagagtaac
ggagctattgaatatattgacgatttgcttaaagaacatggctttaagaccgaggtaaaa
atttttggtgagaccgagcaagttactaatctttatgctgtttatggcaatagtaaacct
aatatttgctttgttgggcatgttgatgtagttcctgctggtgatcctaacctttggcac
aattctaatccctttaaagctcatgagcaggagggaaaaatatatggtagagggacggtt
gatatgaaagggtcaattgcatgttttttagcagctagcttagacttcataaaaaataat
accgattttgtaggctctattagctttttacttactagcgatgaagagggaaaggcaaag
cacggcactaaggagatgctacaatatatatataatcaaggacacgaaattgattttgct
attgttggcgaacctacttgcgaaaaagagataggggacacaattaaaattggcagaaga
ggaagtattaattttaagttggctgtaaaaggcttaggtgggcatgtagcttatccgcaa
aaagcaaataatccactaccttgcttgataagaatattaaacgaactaacaaatattaaa
cttgataaagggactgaattttttcaaaattcaaacctcgaagtaacaaatattgacgtt
gataataatactacaaatgtgattcctgaaacagcaactgtacattttaatatacgtttt
aataacttacatagtgcagaaactctagcaaaacaggtagaagaaattattaaacaacac
tgccaaaagcataaattagattatacgctagaatataatagctctgccgatagttttatt
caaaatcctaatgataagataaaagaatttgctacaatagtagaaaaaactcttaatata
aaaccaaaattttctacaagcggcggtacatccgatgcaagatttgttaaaaattattgc
cccttagtagaattcggtttattatcagacactgcacataaaataaatgaatataccaaa
attagcgatttacaaaaattatacgatgtgtattataattttttaatggaaacattaaat
gttactggatccccgccgttgctgggaatgacataa

DBGET integrated database retrieval system