KEGG   Robiginitalea biformata: RB2501_02210Help
Entry
RB2501_02210      CDS       T00992                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rbi  Robiginitalea biformata
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RB2501_02210
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RB2501_02210
Enzymes [BR:rbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RB2501_02210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3299876..3300661
Genome map
AA seq 261 aa AA seqDB search
MNILDRIAATKREEIALKQLVVPEARLRDSALMQREPASMKASLSARSYGIIAEHKRRSP
SRAVINQALTVQQVVRGYTAGGAGAVSVLTDGTYFGGSLEDLLLARAVTDLPLLRKEFIL
EPYQVLEARAHGADAILLIAALLEPGQIEALAGQARELGMEVLLEVHDREELDKSPLGSA
DMIGVNNRNLKTFEVDLATSHSLAGLIPDTALRITESGLGKPGELRELRDSGYRGFLMGE
SFMKQDDPGKALKAFLKTLEA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcctggaccgaattgcagcgaccaagcgggaggaaattgccctgaaacaactg
gtggtgcccgaagcccggcttcgggattccgccctgatgcagcgggaaccggcttccatg
aaagcctccctctccgcccggagttacggtatcatcgccgagcacaagcgcaggtcgccc
tcccgtgcggtaatcaaccaggcgctcaccgtccagcaggtggtccggggctatacggca
ggaggagccggtgcggtttccgtactgacggacgggacctatttcggcgggtccctggaa
gacctgttgctggcccgggccgtaacggacctgcccctgcttcgcaaggaatttatcctg
gagccctaccaggtactcgaggcgcgggcccacggagcagatgccatcctgttgatagcc
gccctgctggaacccggccaaatcgaagccctcgccggccaggcgcgggaactgggcatg
gaggtcctcctcgaggtacacgaccgggaggaactggacaaatcccccctgggctcggcc
gatatgatcggggtcaacaaccgcaacctgaaaacctttgaagtagacctggccaccagc
cacagcctggcgggcctcatcccggacacggccctgcgcattaccgaaagcggcctgggg
aagcccggggagctgcgggagctgcgggattccggttaccgggggtttttgatgggggaa
tctttcatgaaacaggacgacccgggcaaggcacttaaagcatttctcaaaaccctggaa
gcatga

DBGET integrated database retrieval system