KEGG   Robiginitalea biformata: RB2501_02225Help
Entry
RB2501_02225      CDS       T00992                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rbi  Robiginitalea biformata
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RB2501_02225
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RB2501_02225
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RB2501_02225
Enzymes [BR:rbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RB2501_02225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3302575..3303363
Genome map
AA seq 262 aa AA seqDB search
MKTALPHVSDRLKSTLEKPGKLVSIYFTAGYPELGDTVPILRELQAAGADIVEIGLPFSD
PLADGPTIQESSTAALKNGMHTARLFEQLRGIREEIHIPLILMGYFNPVLQFGVEAFCQK
CQEVGIDGLILPDLPLEIYQRDYQPYFEAAGLSMVFLISPQTSEKRIRQIDAASGSFIYM
VSSASTTGVQDSFGSGQQAYFNRIAGMNLSCPQLVGFGISDAGSFRAATQKAKGAIIGSA
FIRLLTEKGIPGIRDFVKGLRG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcattaccacacgtatccgacaggctgaaaagcaccctggaaaaaccgggg
aaactcgtctccatctattttacggccggataccccgagctcggggataccgtcccgatc
ctgcgggaattgcaggcagccggggccgatatcgtcgaaatcgggctgccattcagcgac
ccgctggcggatgggcccaccatacaggaaagctccacggcagctttaaaaaacggcatg
cacacggcccgcctgtttgaacagctgcggggtatccgggaagaaatccacatcccgttg
atcctgatgggatatttcaacccggtgctgcaattcggggtggaggcgttttgccaaaaa
tgccaggaggtgggtatcgacgggttgattttgccggatctgcccctggagatctaccaa
cgggattaccagccttactttgaagccgccggtttgagcatggtgtttctgatcagcccg
cagacctctgaaaaacggatccgtcaaatcgacgcggcttccggcagtttcatctatatg
gtgagctcggcgagcaccaccggggtccaggacagtttcggctcggggcaacaagcctat
tttaaccggattgccggcatgaacctcagctgcccgcaattggtgggcttcggtatcagc
gacgccgggagtttccgggctgccacgcaaaaggcaaaaggcgcgatcatcggatcggca
tttatccggctcctcaccgagaaggggattccgggtatccgcgattttgtgaaagggttg
agggggtaa

DBGET integrated database retrieval system