KEGG   Robiginitalea biformata: RB2501_02225Help
Entry
RB2501_02225      CDS       T00992                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rbi  Robiginitalea biformata
Pathway
rbi00260  Glycine, serine and threonine metabolism
rbi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rbi01100  Metabolic pathways
rbi01110  Biosynthesis of secondary metabolites
rbi01130  Biosynthesis of antibiotics
rbi01230  Biosynthesis of amino acids
Module
rbi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RB2501_02225
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RB2501_02225
Enzymes [BR:rbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RB2501_02225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: EAR14203
UniProt: A4CP82
Position
3302575..3303363
Genome map
AA seq 262 aa AA seqDB search
MKTALPHVSDRLKSTLEKPGKLVSIYFTAGYPELGDTVPILRELQAAGADIVEIGLPFSD
PLADGPTIQESSTAALKNGMHTARLFEQLRGIREEIHIPLILMGYFNPVLQFGVEAFCQK
CQEVGIDGLILPDLPLEIYQRDYQPYFEAAGLSMVFLISPQTSEKRIRQIDAASGSFIYM
VSSASTTGVQDSFGSGQQAYFNRIAGMNLSCPQLVGFGISDAGSFRAATQKAKGAIIGSA
FIRLLTEKGIPGIRDFVKGLRG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcattaccacacgtatccgacaggctgaaaagcaccctggaaaaaccgggg
aaactcgtctccatctattttacggccggataccccgagctcggggataccgtcccgatc
ctgcgggaattgcaggcagccggggccgatatcgtcgaaatcgggctgccattcagcgac
ccgctggcggatgggcccaccatacaggaaagctccacggcagctttaaaaaacggcatg
cacacggcccgcctgtttgaacagctgcggggtatccgggaagaaatccacatcccgttg
atcctgatgggatatttcaacccggtgctgcaattcggggtggaggcgttttgccaaaaa
tgccaggaggtgggtatcgacgggttgattttgccggatctgcccctggagatctaccaa
cgggattaccagccttactttgaagccgccggtttgagcatggtgtttctgatcagcccg
cagacctctgaaaaacggatccgtcaaatcgacgcggcttccggcagtttcatctatatg
gtgagctcggcgagcaccaccggggtccaggacagtttcggctcggggcaacaagcctat
tttaaccggattgccggcatgaacctcagctgcccgcaattggtgggcttcggtatcagc
gacgccgggagtttccgggctgccacgcaaaaggcaaaaggcgcgatcatcggatcggca
tttatccggctcctcaccgagaaggggattccgggtatccgcgattttgtgaaagggttg
agggggtaa

DBGET integrated database retrieval system