KEGG   Robiginitalea biformata: RB2501_02225Help
Entry
RB2501_02225      CDS       T00992                                 

Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rbi  Robiginitalea biformata
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rbi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rbi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rbi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3302575..3303363
Genome map
AA seq 262 aa AA seqDB search
MKTALPHVSDRLKSTLEKPGKLVSIYFTAGYPELGDTVPILRELQAAGADIVEIGLPFSD
PLADGPTIQESSTAALKNGMHTARLFEQLRGIREEIHIPLILMGYFNPVLQFGVEAFCQK
CQEVGIDGLILPDLPLEIYQRDYQPYFEAAGLSMVFLISPQTSEKRIRQIDAASGSFIYM
VSSASTTGVQDSFGSGQQAYFNRIAGMNLSCPQLVGFGISDAGSFRAATQKAKGAIIGSA
FIRLLTEKGIPGIRDFVKGLRG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcattaccacacgtatccgacaggctgaaaagcaccctggaaaaaccgggg
aaactcgtctccatctattttacggccggataccccgagctcggggataccgtcccgatc
ctgcgggaattgcaggcagccggggccgatatcgtcgaaatcgggctgccattcagcgac
ccgctggcggatgggcccaccatacaggaaagctccacggcagctttaaaaaacggcatg
cacacggcccgcctgtttgaacagctgcggggtatccgggaagaaatccacatcccgttg
atcctgatgggatatttcaacccggtgctgcaattcggggtggaggcgttttgccaaaaa
tgccaggaggtgggtatcgacgggttgattttgccggatctgcccctggagatctaccaa
cgggattaccagccttactttgaagccgccggtttgagcatggtgtttctgatcagcccg
cagacctctgaaaaacggatccgtcaaatcgacgcggcttccggcagtttcatctatatg
gtgagctcggcgagcaccaccggggtccaggacagtttcggctcggggcaacaagcctat
tttaaccggattgccggcatgaacctcagctgcccgcaattggtgggcttcggtatcagc
gacgccgggagtttccgggctgccacgcaaaaggcaaaaggcgcgatcatcggatcggca
tttatccggctcctcaccgagaaggggattccgggtatccgcgattttgtgaaagggttg
agggggtaa

DBGET integrated database retrieval system