KEGG   Robiginitalea biformata: RB2501_02675Help
Entry
RB2501_02675      CDS       T00992                                 

Definition
aspartate aminotransferase
Orthology
K00812  
aspartate aminotransferase [EC:2.6.1.1]
Organism
rbi  Robiginitalea biformata
Pathway
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    RB2501_02675
   01230 Biosynthesis of amino acids
    RB2501_02675
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RB2501_02675
   00270 Cysteine and methionine metabolism
    RB2501_02675
   00330 Arginine and proline metabolism
    RB2501_02675
   00350 Tyrosine metabolism
    RB2501_02675
   00360 Phenylalanine metabolism
    RB2501_02675
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RB2501_02675
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    RB2501_02675
Enzymes [BR:rbi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     RB2501_02675
Amino acid related enzymes [BR:rbi01007]
 Aminotransferase (transaminase)
  Class I
   RB2501_02675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3395493..3396680
Genome map
AA seq 395 aa AA seqDB search
MKQFLSDRINNMATSATLAMAAKARELRQEGKDIIGLSLGEPDFNIPEFIREAAKEAIDQ
NYSSYSPVDGYGDLKQAISRKFARDNGLQYGIDQIVVSTGAKQSLANVAMVMLNEGDEVI
LPAPYWVSYSDIVKLAGGVPVEVPTSIDTDFKMTPDQLREAITPRTKMIWYSSPCNPSGS
VYSKPELEGLAAVLREHPGIFVVSDEIYEHINFREGHVSMAGLEGMYDRTITVNGVSKAY
AMTGWRIGFIGAPAWVAKACTKFQGQITSGANAIAQRATIAALDAPIEKIRYMIDKFHER
RDLILELLGEIPGFNLNVPEGAFYVFPDISSYFGKTLGGKTIANASDFALYLLEAAGVAT
VTGEAFGNPNCIRISYAASEEEIREAVRRMQEALA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttctctccgaccggatcaacaacatggccacgtcggccaccctggctatg
gccgcaaaggcccgggaactgagacaggaaggaaaagacatcatcggcctgagccttggg
gaacccgatttcaacattccggaattcatccgggaggcggccaaagaggccatcgaccag
aactacagcagctattctcctgtagacggctatggcgatttaaaacaggccatttccagg
aaatttgcccgggacaacggcctccagtacggcatcgaccagatcgtagtctccacgggc
gccaagcagtcgcttgccaacgtggccatggtaatgctcaacgagggggatgaagtgatc
ctccccgccccctactgggtgagttattcagacattgtaaaactcgcaggcggcgtgccg
gtggaagtccccaccagtatcgacacggatttcaagatgaccccggaccaactgcgggag
gcgattacgccccggaccaaaatgatctggtacagctcgccctgcaacccgagcggctcc
gtatacagcaaacccgaactggaaggcctcgctgccgtattgcgggaacaccccgggatc
tttgtggtgtccgacgagatttacgaacacatcaatttccgggaaggccatgtgagcatg
gccggcctggagggtatgtacgaccgcacgattaccgtaaacggggtttccaaagcctac
gcgatgaccggttggcggattggctttatcggggcgccggcatgggtggccaaggcctgt
acgaaattccaggggcagatcaccagcggggcaaacgccatcgcccagcgggcaaccatt
gccgccctggatgcccccattgagaagatccggtacatgatcgataaattccacgagcgg
cgggacctgatcctggaattgctcggggaaatccccgggttcaacctgaacgtgccggaa
ggggccttctacgtattcccggacatatcatcgtatttcgggaaaaccctgggcgggaaa
acaattgccaacgcctcggattttgccctctacctgctcgaagcagccggggtggcaacc
gtaaccggcgaggccttcggcaacccgaactgcatccgcatttcctatgcggcttccgag
gaggagatccgggaagcggtgcgcaggatgcaggaagccctggcttag

DBGET integrated database retrieval system