KEGG   Robiginitalea biformata: RB2501_03245Help
Entry
RB2501_03245      CDS       T00992                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rbi  Robiginitalea biformata
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rbi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rbi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3518241..3518738
Genome map
AA seq 165 aa AA seqDB search
MKEIILIAAAGENNELGRESDLPWHLPDDFKRFKELTMGHPMIMGRKTFDTFPKPLPGRK
HIILTRDPDYRADHPACRVVDSMDRALEAADGAETVYIIGGGEIYRQALPLATKIELTRV
HGTFPADTFFPEIDRNDWDLTNSHRHPADAQHAHPFTYQTYERKS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagagattatcctcattgcggctgcaggggaaaacaacgagctgggccgggaatcc
gacctgccatggcacctccctgacgattttaagcgttttaaagagctgaccatggggcac
ccgatgattatggggcgcaaaaccttcgacaccttcccaaaacccttgcccgggaggaaa
cacatcatcctcacacgagatccggactatcgggcagaccatccggcatgtcgcgtggtg
gattccatggaccgggccctggaagcagcggacggggcggaaaccgtctatattatcgga
gggggtgagatctaccgccaggcgctgccactggctacgaaaattgaattgacgcgtgtt
cacggcaccttcccggcggacacctttttcccggaaatcgaccggaacgactgggatctc
acaaactcccaccggcatcccgcggatgcgcaacacgcacacccctttacctaccagacc
tacgagcgcaaatcttag

DBGET integrated database retrieval system