KEGG   Robiginitalea biformata: RB2501_03620Help
Entry
RB2501_03620      CDS       T00992                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rbi  Robiginitalea biformata
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RB2501_03620 (ruvA)
Enzymes [BR:rbi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RB2501_03620 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(75631..76212)
Genome map
AA seq 193 aa AA seqDB search
MIEHLTGRLIEKHPTHLVIECAGVGYFVNISLNTFSALPDEEQLRIYTHLQVREDAHTLF
GFYSVAEREAFRLLISVSGVGASTARTMLSSMTPAQLREAIASGDVPAIQAVKGIGAKTA
QRVILDLRDKILKIYDLDEVSLKPDNTNKEEALSALEVLGYSRKQSEKAVDTVLRQDPSA
SVEGIIKQTLKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacacctaaccggccgccttattgaaaaacacccaacccacctggtaattgaa
tgtgccggggtgggctattttgtcaatatttccctgaataccttttcggccctgccggac
gaggaacaactccggatctatacgcatttgcaggtccgggaagatgcccacacgctcttt
ggattctactctgttgcggagcgcgaggctttccgcctgctgatttcggtttccggcgtg
ggcgcgagcaccgcccgcaccatgttgtcctccatgacccctgcccagctccgggaggca
attgcctccggggatgtgcccgccatacaggctgtcaaggggatcggcgccaagactgcc
cagcgcgttattctggacctgagggacaagattttgaaaatctacgacctcgatgaagtt
tccctaaaaccagacaatacaaataaagaagaagcgttatctgctttagaggttcttggc
tattcccgaaagcagtccgaaaaggccgtggatacggtacttcgccaggatccttccgca
agcgtcgagggcattatcaaacagacgcttaaaaatttgtaa

DBGET integrated database retrieval system