KEGG   Robiginitalea biformata: RB2501_03900Help
Entry
RB2501_03900      CDS       T00992                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rbi  Robiginitalea biformata
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RB2501_03900
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RB2501_03900
  Amino acid metabolism
   00310 Lysine degradation
    RB2501_03900
Enzymes [BR:rbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RB2501_03900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(147900..149192)
Genome map
AA seq 430 aa AA seqDB search
MILEMKVPSPGESITEVEIAQWLVSDGDYVEKDQAIAEVDSDKATLELPAEESGVITLKA
EEGDAVAVGEVVCLIDTDAEKPDASGGKDQEGSAGTDSVGKGDEGSGGNAEKELDKQKEQ
AGQAGGSKAPQPRQAKETYASGVASPAAKKILDEKGIDPASVKGSGKDGRITKDDAVKAV
PSMGSPGGGSRGESRSKLSMLRRKVAERLVSAKNETAMLTTFNEVDMSAVFDIRAEHKEA
FKEKHGVGLGFMSFFTKAVIRALQQFPAVNSMIDGKEMITYDYCDISIAVSGPKGLMVPV
IRNAENLSFRGIEEEVKRLALRARDGQITVDEMTGGTFTISNGGVFGSMLSTPIINPPQS
GILGMHNIVERAIVRDGAIAIAPVMYVALSYDHRIIDGKESVGFLVAIKEAIENPVEHLM
DGDLKKALEL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgattctagaaatgaaagtaccttctccgggcgaatccatcacggaagtggaaattgcc
caatggctcgtttcggacggggactacgtcgaaaaggaccaggccattgccgaggtggac
tccgacaaggccaccctggagttgcccgccgaggaaagcggggtgatcaccttgaaagcc
gaagaaggggatgccgtggccgttggcgaagtcgtttgcctgatcgatacggatgcggaa
aagccggacgcttccgggggcaaagaccaggaaggcagcgccggaacggattccgtgggc
aagggggatgaaggctctggcggaaacgccgaaaaggaactcgacaagcaaaaagaacag
gcaggccaggccgggggatcaaaggccccgcaacccaggcaggccaaggaaacctatgct
tccggggttgcatcgcctgcagcgaagaagatcctcgatgaaaaaggcatcgacccggca
tccgtgaagggctctggaaaagacggccgcattaccaaggacgacgccgttaaagccgtg
ccttccatgggcagccccggaggtggatcccgcggggagtcccggagcaaactttccatg
ttgcggcgcaaggtggccgaacgcctggtatccgccaaaaacgaaacagccatgctgacg
accttcaacgaggtggacatgtctgcggtattcgatatccgtgcggaacacaaggaagct
tttaaggagaagcacggggtgggactcggctttatgtcgttcttcaccaaagccgtgatc
cgggcgctccaacagttcccggcggtgaattccatgatcgacggcaaggaaatgattacc
tacgattactgcgatatcagcatcgccgtgtccggaccgaaaggcttgatggtgccggtg
atccgcaatgcggaaaacctgagtttccgcggcatcgaagaagaggtcaagcgattggcg
ctccgggcccgcgacggacagatcaccgttgacgaaatgaccgggggtacctttacaatc
tccaacggcggcgtcttcggttcgatgctctccaccccgatcatcaacccgccccagagc
ggtatcctggggatgcacaacatcgtcgaacgggccatcgtccgcgacggcgccatcgcc
atcgcgccggtaatgtacgtggcgctttcctacgaccaccggattatcgacgggaaggaa
tctgtcggattcctcgtggctattaaggaggcgatcgagaacccggtggaacacctcatg
gacggggacctgaaaaaagcgttggagctctag

DBGET integrated database retrieval system